Cyanistes caeruleus (blue tit): 111923207 Help Entry 111923207         CDS       T05602                                  Symbol NME6 Name (RefSeq) nucleoside diphosphate kinase 6   KO K00940   nucleoside-diphosphate kinase [EC:2.7.4.6] Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae00230   Purine metabolism ccae00240   Pyrimidine metabolism ccae00983   Drug metabolism - other enzymes ccae01100   Metabolic pathways ccae01232   Nucleotide metabolism ccae01240   Biosynthesis of cofactors Module ccae_M00049   Adenine ribonucleotide biosynthesis, IMP => ADP,ATP ccae_M00050   Guanine ribonucleotide biosynthesis, IMP => GDP,GTP ccae_M00052   Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP ccae_M00053   Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP ccae_M00938   Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP Brite KEGG Orthology (KO) [BR:ccae00001]  09100 Metabolism   09104 Nucleotide metabolism    00230 Purine metabolism     111923207 (NME6)    00240 Pyrimidine metabolism     111923207 (NME6)   09111 Xenobiotics biodegradation and metabolism    00983 Drug metabolism - other enzymes     111923207 (NME6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccae04131]     111923207 (NME6) Enzymes [BR:ccae01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.4  Phosphotransferases with a phosphate group as acceptor     2.7.4.6  nucleoside-diphosphate kinase      111923207 (NME6) Membrane trafficking [BR:ccae04131]  Exocytosis   Calcium ion-dependent exocytosis    Kinases and associated proteins     111923207 (NME6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  NDK Tudor_1_RapA Motif Other DBs NCBI-GeneID:  111923207 NCBI-ProteinID:  XP_023774663 LinkDB All DBs Position 1 AA seq 111 aa AA seqDB search MASGPMWAYILAHENAVPLWRSLMGPTKVFRARHSDPDSIRGAYGLTDTRNTTHGSDSPA SASREIAFFFPEFDERRWYEQDEPRLRRGQLFYSPEERVHRVLRAQEADVT NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggccagtggccccatgtgggcttacatcctggcccacgagaatgctgtccctctctgg agatccctgatgggacccactaaagtgttccgagcccgacacagcgacccagactccatc cgaggtgcctatggcctcacagacaccaggaacacgacccatggctcagattcacctgcc tcagccagcagagaaattgcctttttcttccccgagttcgatgagcggcgctggtacgag caggacgagccccggctccgccgcgggcagctgttctacagccccgaggagcgtgtgcac cgtgtgctcagggcacaggaggcagacgtgacctga

DBGET integrated database retrieval system