Cyanistes caeruleus (blue tit): 111923652 Help Entry 111923652         CDS       T05602                                  Symbol FGF9 Name (RefSeq) fibroblast growth factor 9   KO K04358   fibroblast growth factor Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae04010   MAPK signaling pathway ccae04020   Calcium signaling pathway ccae04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:ccae00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111923652 (FGF9)    04020 Calcium signaling pathway     111923652 (FGF9)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     111923652 (FGF9)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccae04052]     111923652 (FGF9)    00536 Glycosaminoglycan binding proteins [BR:ccae00536]     111923652 (FGF9) Cytokines and neuropeptides [BR:ccae04052]  Cytokines   Growth factors (RTK binding)    111923652 (FGF9) Glycosaminoglycan binding proteins [BR:ccae00536]  Heparan sulfate / Heparin   Growth factors/receptors    111923652 (FGF9) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  111923652 NCBI-ProteinID:  XP_023775269 UniProt:  A0A8C0VPV1 LinkDB All DBs Position 1 AA seq 127 aa AA seqDB search MYIVCFFLHFIGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFE ENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPEKVPELY KDILSQS NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgtacattgtttgttttttccttcatttcataggtatactggaatttatcagtatagca gtgggcttggtcagcatccgaggagtcgacagtggactttatcttggaatgaatgagaaa ggggaactgtatggctcggaaaaattaacccaggagtgtgtattcagagagcaatttgaa gaaaactggtataacacatattcatcaaatctatataaacatgtggacactggaagacga tactacgttgcgttaaataaagatgggactccaagagaagggactaggactaaacggcat caaaaatttacacattttttacctagaccagtggaccctgagaaagtaccagaactatat aaggatattttaagccaaagttga

DBGET integrated database retrieval system