Cyanistes caeruleus (blue tit): 111926781 Help Entry 111926781         CDS       T05602                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae04814   Motor proteins ccae05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccae00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     111926781 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111926781 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ccae03037]     111926781 (DYNLT3)    04812 Cytoskeleton proteins [BR:ccae04812]     111926781 (DYNLT3) Cilium and associated proteins [BR:ccae03037]  Motile cilia and associated proteins   Dynein arm    111926781 (DYNLT3) Cytoskeleton proteins [BR:ccae04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      111926781 (DYNLT3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  111926781 NCBI-ProteinID:  XP_023779256 UniProt:  A0A8C0UWB2 LinkDB All DBs Position 1 AA seq 106 aa AA seqDB search MIFNADEAHNIVKECIESVLGKADYNHNKVNQWTAAIVEQSLTHLVKLGKTYKYIVTCAV MQRSGAGLHTASSCFWDTTTDGTCTVRWENRTMNCIVNVFAVAIIL NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgatcttcaatgctgatgaggcccacaacattgttaaggagtgcattgaaagtgttttg ggcaaggcagattataatcacaacaaagtcaaccaatggactgctgctatagtagaacag tcgctgacccatctggtgaaacttgggaaaacctataagtacattgttacctgtgcagtg atgcagaggagtggagctggtctccacacagcaagctcatgcttctgggataccacaact gatggaacctgcacagtgagatgggaaaaccgaaccatgaactgcattgtcaatgtgttt gctgttgctattatcctgtag

DBGET integrated database retrieval system