Cyanistes caeruleus (blue tit): 111930859 Help Entry 111930859         CDS       T05602                                  Name (RefSeq) histone H2A-like   KO K11251   histone H2A Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae03082   ATP-dependent chromatin remodeling ccae04217   Necroptosis Brite KEGG Orthology (KO) [BR:ccae00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     111930859  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     111930859  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccae03036]     111930859   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccae04147]     111930859 Chromosome and associated proteins [BR:ccae03036]  Eukaryotic type   Nucleosome assembly factors    Histones     111930859 Exosome [BR:ccae04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111930859 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone Motif Other DBs NCBI-GeneID:  111930859 NCBI-ProteinID:  XP_023784919 LinkDB All DBs Position 1 AA seq 92 aa AA seqDB search GNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKL LGKVTIAQGGVLPNIQAVLLPKKTDSHKAKSK NT seq 279 nt NT seq  +upstreamnt  +downstreamnt ggcaactacgcggagcgcgtgggcgccggcgccccggtgtacctggcggccgtgctggag tacctgacggccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacg cgcatcatcccccgccacctgcagctcgccatccgcaacgacgaggagctcaacaagctg ctgggcaaggtgaccatcgcgcagggcggcgtgctgcccaacatccaggccgtgctgctg cccaagaagaccgacagccacaaggcgaaaagcaagtga

DBGET integrated database retrieval system