Cyanistes caeruleus (blue tit): 111931001 Help Entry 111931001         CDS       T05602                                  Symbol NPS Name (RefSeq) neuropeptide S   KO K25691   neuropeptide S Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:ccae00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     111931001 (NPS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccae04052]     111931001 (NPS) Cytokines and neuropeptides [BR:ccae04052]  Neuropeptides   GPCR binding    111931001 (NPS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Neuropeptide_S Motif Other DBs NCBI-GeneID:  111931001 NCBI-ProteinID:  XP_023785068 LinkDB All DBs Position 6 AA seq 99 aa AA seqDB search MSSLCRLNLVFILWISMTLVGLGFPVGPSMSTNPFYLTCQLYGKWDSCLVLLSSCLSKVG RDEELPLGKPLLEPPLHKRSFRNGVGAGIKKTSFRRAKS NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgagcagtctatgcaggctaaacttggttttcatcctgtggatctccatgaccttggtg ggcttgggtttcccagttggcccttccatgagcaccaaccctttttatttgacctgccag ctgtacgggaaatgggattcgtgcctggtgctgctgagcagctgcctctccaaggtgggc agggatgaggagctgcctcttgggaagcctctcctggagccccctctccacaaaaggtcc ttccgcaacggcgtcggagcgggaattaaaaaaacttccttccgaagggcaaaatcctga

DBGET integrated database retrieval system