Cyanistes caeruleus (blue tit): 111933244 Help Entry 111933244         CDS       T05602                                  Symbol PFN2 Name (RefSeq) profilin-2   KO K05759   profilin Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae04810   Regulation of actin cytoskeleton ccae05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccae00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     111933244 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111933244 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccae04131]     111933244 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ccae04812]     111933244 (PFN2)    04147 Exosome [BR:ccae04147]     111933244 (PFN2) Membrane trafficking [BR:ccae04131]  Others   Actin-binding proteins    Others     111933244 (PFN2) Cytoskeleton proteins [BR:ccae04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      111933244 (PFN2) Exosome [BR:ccae04147]  Exosomal proteins   Proteins found in most exosomes    111933244 (PFN2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  111933244 NCBI-ProteinID:  XP_023788477 LinkDB All DBs Position 9 AA seq 91 aa AA seqDB search MIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRV LVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgattgtaggaaaagaccgagagggtttcttcaccaatggtctgacccttggtgcaaag aagtgctctgtgatcagagatagcctgtatgtcgatggtgactgcacaatggacatcagg acaaagagtcaaggtggtgagccgacatataatgttgctgtaggcagagctggacgagtc ttggtctttgtaatgggcaaagaaggggtccatggaggcggattgaataagaaggcatac tcaatggcaaaatacttgagagactctgggttctag

DBGET integrated database retrieval system