Cyanistes caeruleus (blue tit): 111933613 Help Entry 111933613         CDS       T05602                                  Symbol SST Name (RefSeq) somatostatin   KO K05237   somatostatin Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae04080   Neuroactive ligand-receptor interaction ccae04081   Hormone signaling Brite KEGG Orthology (KO) [BR:ccae00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     111933613 (SST)    04081 Hormone signaling     111933613 (SST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccae04052]     111933613 (SST) Cytokines and neuropeptides [BR:ccae04052]  Neuropeptides   GPCR binding    111933613 (SST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Somatostatin Motif Other DBs NCBI-GeneID:  111933613 NCBI-ProteinID:  XP_023789046 LinkDB All DBs Position 9 AA seq 77 aa AA seqDB search MALSARAELAKYFLAELLSEPSQTENEALESEDLSRGAEQDEVRLELERSANSNPALAPR ERKAGCKNFFWKTFTSC NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcgctgagtgcccgagccgaactggccaagtactttttggcagaactgctttcagag ccaagtcagacagaaaatgaagccctggagtctgaggacttgtcccgaggggctgagcag gatgaagtgagactggagctggagcgctcggctaactcaaaccccgctctggcaccccgg gaacgcaaagcaggctgcaagaacttcttctggaaaactttcacatcctgttag

DBGET integrated database retrieval system