Cyanistes caeruleus (blue tit): 111935090 Help Entry 111935090         CDS       T05602                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae04137   Mitophagy - animal ccae04140   Autophagy - animal ccae04144   Endocytosis ccae04145   Phagosome ccae04148   Efferocytosis ccae05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccae00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111935090 (RAB7A)    04145 Phagosome     111935090 (RAB7A)    04140 Autophagy - animal     111935090 (RAB7A)    04137 Mitophagy - animal     111935090 (RAB7A)    04148 Efferocytosis     111935090 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     111935090 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccae04131]     111935090 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccae04147]     111935090 (RAB7A)    04031 GTP-binding proteins [BR:ccae04031]     111935090 (RAB7A) Membrane trafficking [BR:ccae04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     111935090 (RAB7A) Exosome [BR:ccae04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111935090 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    111935090 (RAB7A)   Exosomal proteins of colorectal cancer cells    111935090 (RAB7A)   Exosomal proteins of bladder cancer cells    111935090 (RAB7A) GTP-binding proteins [BR:ccae04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     111935090 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC FLYWCH_N ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  111935090 NCBI-ProteinID:  XP_023791118 LinkDB All DBs Position 12 AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKTDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctaggaagaaagtgttactgaaagtcatcatccttggagactcaggggtggga aagacatcgctcatgaaccagtatgtgaacaagaaattcagtaaccagtacaaggctacg ataggcgcagatttcctgacaaaagaggtgatggtggatgacaggctagtgacaatgcag atatgggatacagcaggccaagagcgatttcagtctctgggagttgccttctacagggga gcagactgctgtgtgctggtatttgatgtcacggctcccaacacattcaagaccctagac agctggagggacgaattcctcattcaggccagtccaagggatcctgagaattttcctttt gttgtgctgggaaacaagattgacctagaaaacagacaagtcaccacaaaacgggcacaa gcctggtgctacagtaaaaacaacatcccctactttgaaaccagtgccaaggaggccatt aatgtggaacaagctttccaaacgattgcacgaaatgcacttaaacaggaaaccgaagtg gaactttacaatgaattccccgaacccatcaaactagacaagactgaccgagcgaaggct tctgcggagagctgcagctgctga

DBGET integrated database retrieval system