Cyanistes caeruleus (blue tit): 111936136 Help Entry 111936136         CDS       T05602                                  Symbol IGF1 Name (RefSeq) insulin-like growth factor I   KO K05459   insulin-like growth factor 1 Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae04010   MAPK signaling pathway ccae04068   FoxO signaling pathway ccae04081   Hormone signaling ccae04114   Oocyte meiosis ccae04115   p53 signaling pathway ccae04150   mTOR signaling pathway ccae04510   Focal adhesion ccae04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:ccae00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     111936136 (IGF1)    04068 FoxO signaling pathway     111936136 (IGF1)    04150 mTOR signaling pathway     111936136 (IGF1)   09133 Signaling molecules and interaction    04081 Hormone signaling     111936136 (IGF1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     111936136 (IGF1)    04115 p53 signaling pathway     111936136 (IGF1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     111936136 (IGF1)  09150 Organismal Systems   09152 Endocrine system    04914 Progesterone-mediated oocyte maturation     111936136 (IGF1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccae04052]     111936136 (IGF1) Cytokines and neuropeptides [BR:ccae04052]  Cytokines   Growth factors (RTK binding)    111936136 (IGF1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  111936136 NCBI-ProteinID:  XP_023792657 UniProt:  A0A8C0UMU9 LinkDB All DBs Position 1 AA seq 153 aa AA seqDB search MEKINSLSTQLVKCCLCDFLKVKMHTVSYIHFFYLGLCLLTLTSSVAAGPETLCGAELVD ALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSARS VRAQRHTDMPKAQKEVHLKNTSRGNTGNRNYRM NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggaaaaaatcaacagtctttcaacacaattagttaagtgctgcttgtgtgatttcttg aaggtgaagatgcacactgtgtcctacatccatttcttctaccttggcctgtgtttgctt accttaaccagttctgttgctgctggcccagaaacactctgtggtgctgagctggttgat gctcttcagttcgtgtgtggagacagaggcttttacttcagtaagcccacggggtatgga tccagcagtagacgtttacaccacaagggaatagtggatgaatgctgcttccagagttgt gacctgagaaggctggagatgtattgtgctccaataaagccgccaaaatccgcacggtcc gtacgtgcccagcgccacaccgacatgccaaaagcacaaaaggaagtgcatttgaagaac acaagtagagggaacacaggaaacagaaactacagaatgtaa

DBGET integrated database retrieval system