Cyanistes caeruleus (blue tit): 111936908 Help Entry 111936908         CDS       T05602                                  Symbol POLE3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae03030   DNA replication ccae03082   ATP-dependent chromatin remodeling ccae03410   Base excision repair ccae03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ccae00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     111936908 (POLE3)    03410 Base excision repair     111936908 (POLE3)    03420 Nucleotide excision repair     111936908 (POLE3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     111936908 (POLE3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ccae03032]     111936908 (POLE3)    03036 Chromosome and associated proteins [BR:ccae03036]     111936908 (POLE3)    03400 DNA repair and recombination proteins [BR:ccae03400]     111936908 (POLE3) Enzymes [BR:ccae01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      111936908 (POLE3) DNA replication proteins [BR:ccae03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     111936908 (POLE3) Chromosome and associated proteins [BR:ccae03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     111936908 (POLE3) DNA repair and recombination proteins [BR:ccae03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       111936908 (POLE3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C SpoU_methylase BUD22 RNA_pol_3_Rpc31 CIS_TMP Astro_capsid_p DUF4746 Afi1 NOA36 CDC45 Motif Other DBs NCBI-GeneID:  111936908 NCBI-ProteinID:  XP_023793819 UniProt:  A0A8C0VTK2 LinkDB All DBs Position 17 AA seq 143 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGK RKTLNAGDVLSAMEEMEFQRFVAPLKESLEVYRREQKGKKEARKDKDKKADSEEQDKSRE EDNDDDDERMDEEEQNDEDEVDN NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atggcggagagaccggaggacctgaacctgcccaacgccgtcatcacccgcatcatcaag gaggcgcttcctgatggagtcaatatttccaaagaagcccggagcgcgatctcccgagca gcgagcgtgtttgtgctgtatgcaacatcatgtgcaaataactttgccatgaaggggaag aggaaaaccctgaatgctggggacgtgctctctgccatggaggagatggagttccagaga ttcgtggcccctctgaaggaatccctggaagtttacaggcgcgagcagaaaggaaagaaa gaggccaggaaagataaagacaagaaggcagactcggaggagcaagataagagccgagag gaggacaatgatgacgatgatgaaaggatggacgaggaagaacaaaacgatgaggatgag gtggacaactga

DBGET integrated database retrieval system