Cyanistes caeruleus (blue tit): 111937042 Help Entry 111937042         CDS       T05602                                  Symbol CAV1 Name (RefSeq) caveolin-1   KO K06278   caveolin 1 Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae04144   Endocytosis ccae04510   Focal adhesion ccae05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ccae00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111937042 (CAV1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     111937042 (CAV1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     111937042 (CAV1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccae04131]     111937042 (CAV1) Membrane trafficking [BR:ccae04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     111937042 (CAV1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  111937042 NCBI-ProteinID:  XP_023794055 LinkDB All DBs Position 1 AA seq 125 aa AA seqDB search CLTDPTLCSLPQIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSAIFGIPMAL IWGIYFAILSFLHIWAVVPCIRSYLIEIQCISRVYSICIHTFCDPLFEAIGKVFSSIRAT VRKEI NT seq 378 nt NT seq  +upstreamnt  +downstreamnt tgtctgactgacccgactttgtgttctttgccgcagatcgattttgaagatgtgattgct gagccagagggaacacacagctttgatgggatttggaaggccagttttaccaccttcact gtaacgaaatactggttttatcgtttactgtcagcaatctttggtattcctatggctctc atctggggcatctactttgccattttgtcattcctgcacatctgggcggtggtgccgtgc ataaggagctacctgattgagatccagtgcattagccgtgtctattccatctgcatccac accttctgcgacccgctctttgaggccataggcaaagtgttcagcagcatccgagccaca gtacggaaagagatctga

DBGET integrated database retrieval system