Cyanistes caeruleus (blue tit): 111937917 Help Entry 111937917         CDS       T05602                                  Symbol CLDN3 Name (RefSeq) claudin-3   KO K06087   claudin Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae03272   Virion - Hepatitis viruses ccae04382   Cornified envelope formation ccae04514   Cell adhesion molecules ccae04530   Tight junction Brite KEGG Orthology (KO) [BR:ccae00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     111937917 (CLDN3)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     111937917 (CLDN3)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     111937917 (CLDN3)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     111937917 (CLDN3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ccae03037]     111937917 (CLDN3)    04147 Exosome [BR:ccae04147]     111937917 (CLDN3)    04515 Cell adhesion molecules [BR:ccae04515]     111937917 (CLDN3) Cilium and associated proteins [BR:ccae03037]  Other cilia and associated proteins   Stereociliary proteins    111937917 (CLDN3) Exosome [BR:ccae04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    111937917 (CLDN3)   Exosomal proteins of colorectal cancer cells    111937917 (CLDN3) Cell adhesion molecules [BR:ccae04515]  Immunoglobulin superfamily   L1 family    111937917 (CLDN3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF7139 TMEM37 TMEM_230_134 CyanoTRADDas_TM Motif Other DBs NCBI-GeneID:  111937917 NCBI-ProteinID:  XP_023795258 LinkDB All DBs Position 19 AA seq 171 aa AA seqDB search MSMGLEIGGVALSVLGWLCSIICCALPMWKVSAFIGNNIVTAQILWEGLWMSCVVQSTGQ MQCKVYDSMLALPQDLQAARALLVVAIILAVLGLMVAIVGAQCTRCVEDESTKAKITIVS GVIFLLSGVMTLIPVCWSANTIIRDFYNPLVIEAQKRELGTSLYVGLDAAL NT seq 516 nt NT seq  +upstreamnt  +downstreamnt atgtccatggggctggagattggcggcgtggccttgtctgtgctgggttggttgtgcagc atcatctgctgcgcgctgcccatgtggaaggtgtcggccttcatcggcaacaacatcgtg acggcgcagatcctgtgggaagggctgtggatgagctgcgtggtgcagagcacggggcag atgcagtgcaaggtctacgactccatgttggcgctgccacaggacctgcaagccgcccgc gccctgctggtggtggccatcatcttggccgtcctgggcttaatggtggccatcgtggga gcccagtgcacccgctgcgtggaggacgagagcaccaaagccaagatcaccatcgtctcc ggcgtcatcttcctcctctctggtgtaatgaccctcatccctgtctgctggtcggccaac accatcatccgggatttctacaacccgctggtgatcgaagcgcagaagcgagagctgggc acctcgctctacgtgggactggacgcagcgctctaa

DBGET integrated database retrieval system