Cyanistes caeruleus (blue tit): 111939714 Help Entry 111939714         CDS       T05602                                  Name (RefSeq) glutathione S-transferase 2-like   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae00480   Glutathione metabolism ccae00980   Metabolism of xenobiotics by cytochrome P450 ccae00982   Drug metabolism - cytochrome P450 ccae00983   Drug metabolism - other enzymes ccae01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:ccae00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     111939714   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     111939714    00982 Drug metabolism - cytochrome P450     111939714    00983 Drug metabolism - other enzymes     111939714  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ccae02000]     111939714 Enzymes [BR:ccae01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      111939714 Transporters [BR:ccae02000]  Other transporters   Pores ion channels [TC:1]    111939714 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C GST_C_3 GST_N GST_C_6 GST_N_3 GST_C_2 YpzG GST_C_7 Motif Other DBs NCBI-GeneID:  111939714 NCBI-ProteinID:  XP_023797805 UniProt:  A0A8C0UBG4 LinkDB All DBs Position 26 AA seq 183 aa AA seqDB search MGRGWEGDVGVTGVTRTPGTPQLPYLIDGSTKLTQSNAILRYIARKHNMCGETEEEKQRI DLLENQLMDLRMNFARICYSPDFEKLKPAYLEQLPKKLQELSRFLGSRPWFAGQKITYVD FLAYDVLDQQRMFVPECPELKGNLAQFLQRFEALDKVSAYMRSGRFMKTPIFWRTAKWCN SKE NT seq 552 nt NT seq  +upstreamnt  +downstreamnt atggggagggggtgggaaggggatgtgggggtcaccggggtgactcggacccccggcacc ccccagctcccgtacctcatcgacggctccaccaagctgacccagagcaacgccatcctg cgctacatcgcccgcaagcacaacatgtgtggcgagacggaggaggagaagcagcgcata gacctgctggaaaaccagctcatggatttgaggatgaactttgcccggatctgctacagc cctgactttgagaagctgaagccggcctacctggagcagctgcccaagaagctgcaggag ctgtctcggttcctgggctcccggccctggtttgcggggcagaagatcacctacgtggac ttcctggcgtacgacgtgctggaccagcagcgcatgttcgtgcccgagtgtcccgagctg aagggaaacctggcccagttcctgcagcgcttcgaggccctggacaaggtctctgcctac atgcgctcggggcgcttcatgaaaaccccgattttctggcgcacggccaagtggtgcaac agcaaggagtga

DBGET integrated database retrieval system