Cyanistes caeruleus (blue tit): 111941598 Help Entry 111941598         CDS       T05602                                  Symbol AK6 Name (RefSeq) adenylate kinase isoenzyme 6   KO K18532   adenylate kinase [EC:2.7.4.3] Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae00230   Purine metabolism ccae01100   Metabolic pathways ccae01232   Nucleotide metabolism ccae01240   Biosynthesis of cofactors ccae03008   Ribosome biogenesis in eukaryotes Module ccae_M00049   Adenine ribonucleotide biosynthesis, IMP => ADP,ATP Brite KEGG Orthology (KO) [BR:ccae00001]  09100 Metabolism   09104 Nucleotide metabolism    00230 Purine metabolism     111941598 (AK6)  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     111941598 (AK6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:ccae03009]     111941598 (AK6) Enzymes [BR:ccae01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.4  Phosphotransferases with a phosphate group as acceptor     2.7.4.3  adenylate kinase      111941598 (AK6) Ribosome biogenesis [BR:ccae03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     111941598 (AK6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  AAA_18 AAA_17 AAA AAA_22 AAA_28 nSTAND3 AAA_16 SKI AAA_14 NTPase_1 Cytidylate_kin2 AAA_33 KTI12 AAA_5 Rad17 AAA_24 ATPase ADK RNA_helicase AAA_19 AAA_3 Cytidylate_kin RuvB_N AAA_29 NACHT IstB_IS21 AAA_30 Motif Other DBs NCBI-GeneID:  111941598 NCBI-ProteinID:  XP_023800511 UniProt:  A0A8C0U452 LinkDB All DBs Position Z AA seq 171 aa AA seqDB search MRRPNLLITGTPGVGKTTLGKELASRAGLSYINVGDLAKEGELYEGFDEEYECPILDEDR VIDELEDRMSEGGVIVDYHGCDFFPERWFHIVFVLRTDNSCLYDRLESRGYTGKKLQDNI QCEIFQTLYEEAVLSYKREIVHQLPSNTPEDLERNLDQIMQWIEQWMKDNN NT seq 516 nt NT seq  +upstreamnt  +downstreamnt atgaggaggccgaacctgctgatcaccggcacgccgggagttgggaaaaccacgctggga aaggagctggcatccagagctgggctgagctacatcaacgtgggggacctggccaaggaa ggagagctgtatgaaggctttgatgaggaatacgagtgccccattttggatgaagacagg gtgatcgatgagctggaggacaggatgagcgagggaggggtgattgtggattaccacggc tgtgacttcttccccgagcgctggttccacatcgtctttgtgcttcgcacggacaactcc tgcctgtacgacaggctggagagcaggggctacacggggaagaagctgcaggacaacatt cagtgtgaaatttttcagactctgtatgaggaagctgtgttgtcatataaaagggaaatt gtacaccaattacccagcaacactccagaggacctagagagaaatttggatcagattatg caatggattgagcaatggatgaaggacaacaactga

DBGET integrated database retrieval system