Cyanistes caeruleus (blue tit): 111943090 Help Entry 111943090         CDS       T05602                                  Name (RefSeq) histone H3, embryonic-like   KO K11253   histone H3 Organism ccae  Cyanistes caeruleus (blue tit) Brite KEGG Orthology (KO) [BR:ccae00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccae03036]     111943090   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccae04147]     111943090 Chromosome and associated proteins [BR:ccae03036]  Eukaryotic type   Nucleosome assembly factors    Histones     111943090 Exosome [BR:ccae04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    111943090 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone PAF Motif Other DBs NCBI-GeneID:  111943090 NCBI-ProteinID:  XP_023801895 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIA NT seq 227 nt NT seq  +upstreamnt  +downstreamnt atggcgcgcacgaagcagacggcgcgtaagtcgacgggcgggaaggcgccccgcaagcag ctggccaccaaggctgcccgcaagagcgcgccggccacgggcggcgtcaagaagccgcac cgctaccggcccggcacggtggcgctgcgcgagatccggcgctaccagaagtccacggag ctgctgatccgcaagctgcccttccagcgcctggtgcgcgagatcgc

DBGET integrated database retrieval system