Cyanistes caeruleus (blue tit): 111943565 Help Entry 111943565         CDS       T05602                                  Symbol TMEM218 Name (RefSeq) transmembrane protein 218   KO K26674   transmembrane protein 218 Organism ccae  Cyanistes caeruleus (blue tit) Brite KEGG Orthology (KO) [BR:ccae00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ccae03037]     111943565 (TMEM218) Cilium and associated proteins [BR:ccae03037]  Primary cilia and associated proteins   MKS complex    111943565 (TMEM218) BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-GeneID:  111943565 NCBI-ProteinID:  XP_023802285 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MGRKDARRNPGGNGLLPQPQPRYHPRCPGDCPGLLPGLPLAQPVSLMEPIVDTFLIGRFI LLAVMSLVFLGCLFLFLIFHLMEPVFAKPLHSS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgggccgcaaggatgcccggaggaatcccggagggaacgggcttttacctcagccacag ccccggtaccatccccggtgcccaggagattgccccgggctccttcccggtctcccgctg gcacagcctgtgtcgctcatggagccgatcgtggacaccttcctcatcggccgtttcatc ctcctggctgtgatgagcctggtcttccttggctgcctgttcctgttcctgattttccac ctcatggagcccgtgttcgccaagccactccacagcagctag

DBGET integrated database retrieval system