Cyanistes caeruleus (blue tit): 111943740 Help Entry 111943740         CDS       T05602                                  Symbol ATG12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae04068   FoxO signaling pathway ccae04136   Autophagy - other ccae04140   Autophagy - animal ccae04621   NOD-like receptor signaling pathway ccae04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:ccae00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     111943740 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     111943740 (ATG12)    04136 Autophagy - other     111943740 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     111943740 (ATG12)    04622 RIG-I-like receptor signaling pathway     111943740 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccae04131]     111943740 (ATG12)    04121 Ubiquitin system [BR:ccae04121]     111943740 (ATG12)    03029 Mitochondrial biogenesis [BR:ccae03029]     111943740 (ATG12) Membrane trafficking [BR:ccae04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     111943740 (ATG12) Ubiquitin system [BR:ccae04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    111943740 (ATG12) Mitochondrial biogenesis [BR:ccae03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     111943740 (ATG12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  111943740 NCBI-ProteinID:  XP_023802421 LinkDB All DBs Position Unknown AA seq 111 aa AA seqDB search MGGGDGRCGPMSDGGRALCDTLFPAVDVLLKAVGDTPIMRTKKWAVERTRTIQGLVDFIK KFLKLMASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKTQAWG NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgggcggcggggacggacggtgtgggccaatgagcgacggggggcgggccctctgtgac acgctgtttcccgcagttgatgtgctgctgaaggctgtgggcgacacccccatcatgagg accaagaaatgggcggtggagcggacccggaccatccagggcctcgtggacttcatcaag aagttcctcaagctgatggcctccgaacagctgttcatatatgttaatcagtcttttgct ccatctccagaccaagaagtggggaccctctatgagtgttttggaagtgatggcaagctg gtactgcattattgcaaaactcaggcttggggatga

DBGET integrated database retrieval system