Cyanistes caeruleus (blue tit): 111943854 Help Entry 111943854         CDS       T05602                                  Symbol BAX Name (RefSeq) apoptosis regulator BAX   KO K02159   apoptosis regulator BAX Organism ccae  Cyanistes caeruleus (blue tit) Pathway ccae04115   p53 signaling pathway ccae04141   Protein processing in endoplasmic reticulum ccae04210   Apoptosis ccae04217   Necroptosis ccae05132   Salmonella infection ccae05164   Influenza A ccae05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:ccae00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111943854 (BAX)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     111943854 (BAX)    04217 Necroptosis     111943854 (BAX)    04115 p53 signaling pathway     111943854 (BAX)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     111943854 (BAX)    05168 Herpes simplex virus 1 infection     111943854 (BAX)   09171 Infectious disease: bacterial    05132 Salmonella infection     111943854 (BAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:ccae03029]     111943854 (BAX)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ccae02000]     111943854 (BAX) Mitochondrial biogenesis [BR:ccae03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     111943854 (BAX) Transporters [BR:ccae02000]  Other transporters   Pores ion channels [TC:1]    111943854 (BAX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 Motif Other DBs NCBI-GeneID:  111943854 NCBI-ProteinID:  XP_023802505 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MELQRMIEQVGCDAPKKLFFRVAKEMFADGTFNWGRVVALFYFACKLVLKALCTKVPELV QTILRWTMEYVQEHVLAWIQAQGGWEGLLSHFGTPTWQTITIFAAGVLTASLTIWKMS NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggagctgcagaggatgattgagcaggtggggtgtgatgcccccaaaaagctgtttttc cgtgtggccaaggagatgttcgccgatggcaccttcaactggggccgtgtggttgccctg ttctactttgcgtgcaaactggtgctgaaggctctctgcaccaaggtcccggagctggtc cagactatcctgcgctggaccatggagtatgtccaggaacacgtgctggcctggatccag gcccagggcggatgggaagggctcttgtcccacttcgggacccccacctggcagaccatc accatcttcgccgctggtgtcctcacggcctcgctgaccatctggaagatgtcgtag

DBGET integrated database retrieval system