Conexivisphaera calida: NAS2_0375 Help Entry NAS2_0375         CDS       T06635                                  Name (GenBank) SSU ribosomal protein S27Ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism ccai  Conexivisphaera calida Pathway ccai03010   Ribosome Brite KEGG Orthology (KO) [BR:ccai00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     NAS2_0375   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     NAS2_0375  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:ccai03011]     NAS2_0375    04121 Ubiquitin system [BR:ccai04121]     NAS2_0375   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccai04147]     NAS2_0375 Ribosome [BR:ccai03011]  Ribosomal proteins   Eukaryotes    Small subunit     NAS2_0375   Archaea     NAS2_0375 Ubiquitin system [BR:ccai04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    NAS2_0375 Exosome [BR:ccai04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    NAS2_0375   Exosomal proteins of colorectal cancer cells    NAS2_0375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_NUD Rcat_RNF216 Zn_ribbon_recom DUF7564 Zn_ribbon_NrdR Zn_ribbon_IS1595 FtrD-like IBR_1 Cas12f1-like_TNB Motif Other DBs NCBI-ProteinID:  BBE41766 UniProt:  A0A4P2VB69 LinkDB All DBs Position complement(330573..330794) Genome browser AA seq 73 aa AA seqDB search MKGKGVQVWKYYKVEGGTLTRLRRECPRCGPGVFMAQHADRLYCGRCGHTMWLSSSSGSK SSGQRGTGRGRRQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt gtgaaggggaagggggtccaggtctggaagtactacaaggtggagggaggaaccctcacc aggctgaggagggagtgccccaggtgcggtcccggcgtcttcatggcgcagcacgccgac aggctctactgcggaaggtgcggccacaccatgtggctgagctcgagctctggctctaaa tcctcaggccagagaggaactgggagaggacgccggcaatag

DBGET integrated database retrieval system