Conexivisphaera calida: NAS2_1307 Help Entry NAS2_1307         CDS       T06635                                  Name (GenBank) DNA/RNA-binding protein Alba   KO K03622   DNA/RNA-binding protein Alba Organism ccai  Conexivisphaera calida Brite KEGG Orthology (KO) [BR:ccai00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccai03036]     NAS2_1307 Chromosome and associated proteins [BR:ccai03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     NAS2_1307 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Alba Rpp20 Motif Other DBs NCBI-ProteinID:  BBE42695 UniProt:  A0A4P2VP77 LinkDB All DBs Position 1275413..1275679 Genome browser AA seq 88 aa AA seqDB search MVLIGKKPPMNYVLAVLTLFQNGQDQVILKARGMAISKAVDVSQILKNRFLKDVEVKDIR IGTEQVDNQQTGGKSNVSSIEIVLQRGA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt gtggtcctgatcggcaagaaaccgcccatgaactacgttctggccgtcctcaccctgttc cagaacggccaggatcaggtgatcctgaaggccaggggaatggccatcagcaaggcggtc gacgtctcccagatattgaagaaccggttcctgaaggacgtcgaagtcaaggatatacgc ataggaacggagcaggtggacaaccagcagaccggcggcaagagcaacgtcagcagcatc gagatagtgctccagcgcggcgcctga

DBGET integrated database retrieval system