Cajanus cajan (pigeon pea): 109787705 Help Entry 109787705         CDS       T04868                                  Name (RefSeq) 10 kDa chaperonin, mitochondrial   KO K04078   chaperonin GroES Organism ccaj  Cajanus cajan (pigeon pea) Brite KEGG Orthology (KO) [BR:ccaj00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ccaj03110]     109787705    03029 Mitochondrial biogenesis [BR:ccaj03029]     109787705 Chaperones and folding catalysts [BR:ccaj03110]  Heat shock proteins   HSP10    109787705 Mitochondrial biogenesis [BR:ccaj03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     109787705 SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-GeneID:  109787705 NCBI-ProteinID:  XP_020201846 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MAKRLIPSFNRVLIEKIVPPSKTSAGILLPEKSSQLNSGKVIAVGPGSRDKAGNLIPPSV KEGDHVLLPEYGGTQIKLDDKEFHLFRDEDILGILHG NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggcgaagcgtttgattccgagcttcaatcgcgttctcattgagaaaatcgttcctccc tccaagaccagcgccggcattctcctccctgagaagtcttcacagcttaattcggggaag gtgatagcggttggacctggatcgcgagacaaggcagggaacttgattccaccttccgtc aaggaaggtgaccacgtgctcttgccggagtacggtggcacgcaaatcaagctcgatgac aaagagtttcatttgtttagggatgaagacattttgggtattctccatggttga

DBGET integrated database retrieval system