Cajanus cajan (pigeon pea): 109789755 Help Entry 109789755         CDS       T04868                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism ccaj  Cajanus cajan (pigeon pea) Pathway ccaj04016   MAPK signaling pathway - plant ccaj04070   Phosphatidylinositol signaling system ccaj04075   Plant hormone signal transduction ccaj04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:ccaj00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     109789755    04070 Phosphatidylinositol signaling system     109789755    04075 Plant hormone signal transduction     109789755  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     109789755  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ccaj01009]     109789755   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccaj04131]     109789755    03036 Chromosome and associated proteins [BR:ccaj03036]     109789755   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccaj04147]     109789755 Protein phosphatases and associated proteins [BR:ccaj01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      109789755 Membrane trafficking [BR:ccaj04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     109789755 Chromosome and associated proteins [BR:ccaj03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      109789755 Exosome [BR:ccaj04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    109789755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 DUF5580_M Dockerin_1 EFhand_Ca_insen RNA_pol_Rpb4 Caleosin MotA_activ SPEF2_C FCaBP_EF-hand SurA_N_3 PA_Ig-like DUF6279 Fe_hyd_lg_C MecA_N Motif Other DBs NCBI-GeneID:  109789755 NCBI-ProteinID:  XP_020204374 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccaactcaccgacgaccagatcgccgagttcaaggaggccttcagcctcttc gacaaggacggcgatggttgtattactaccaaggaacttgggactgtgatgcggtcactt ggtcaaaacccaactgaggcagagctgcaggatatgataaatgaggttgatgctgatggc aatggaaccatcgatttccctgagttcctgaacctgatggctcgcaagatgaaggacact gattcagaggaggagcttaaggaggctttccgtgtgtttgacaaggatcagaatggtttc atctctgcagctgagcttcgccatgttatgacgaatctcggcgagaagctgacagatgag gaggttgatgagatgattcgtgaggccgatgttgatggagatgggcagatcaactatgag gagttcgtcaaagtcatgatggccaagtga

DBGET integrated database retrieval system