Cajanus cajan (pigeon pea): 109793922 Help Entry 109793922         CDS       T04868                                  Name (RefSeq) polyubiquitin 8 isoform X1   KO K03873   elongin-B Organism ccaj  Cajanus cajan (pigeon pea) Pathway ccaj04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ccaj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     109793922  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ccaj04121]     109793922    03400 DNA repair and recombination proteins [BR:ccaj03400]     109793922 Ubiquitin system [BR:ccaj04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      109793922    Cul5 complex      109793922 DNA repair and recombination proteins [BR:ccaj03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      109793922 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD UBL_UBAC1 Dsc3_N YmzB Ubiquitin_2 FlaG DNA_pol3_delta Chal_sti_synt_N Motif Other DBs NCBI-GeneID:  109793922 NCBI-ProteinID:  XP_020208981 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MDMYIRVKRSKTTYFIRCKPSDKTLDIKQKLQELVDQPANNQRLILHGTGEVLEDSKTLA DQKVENDAVVALTLRKDDNEFEEINIVRPNDFYQARDADGASW NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atggatatgtacattcgtgttaaacgtagtaagacaacatacttcatccggtgcaagccg tctgataaaactcttgacataaagcagaagttgcaagaacttgttgatcagccagctaat aatcaacggttaattctacatggaacaggggaagtgttagaagactctaagactctggca gatcaaaaggttgaaaatgatgctgttgttgcactgaccttgagaaaagatgataatgag tttgaggagatcaacattgtccggccaaatgatttctaccaagcacgggatgcggacggt gccagttggtaa

DBGET integrated database retrieval system