Cajanus cajan (pigeon pea): 109795796 Help Entry 109795796         CDS       T04868                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism ccaj  Cajanus cajan (pigeon pea) Pathway ccaj03083   Polycomb repressive complex ccaj04120   Ubiquitin mediated proteolysis ccaj04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ccaj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109795796    04120 Ubiquitin mediated proteolysis     109795796   09126 Chromosome    03083 Polycomb repressive complex     109795796  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccaj04131]     109795796    04121 Ubiquitin system [BR:ccaj04121]     109795796    03036 Chromosome and associated proteins [BR:ccaj03036]     109795796 Membrane trafficking [BR:ccaj04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     109795796 Ubiquitin system [BR:ccaj04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      109795796    Cul7 complex      109795796 Chromosome and associated proteins [BR:ccaj03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      109795796   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      109795796 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ BTB KTI12 Nlig-Ia Motif Other DBs NCBI-GeneID:  109795796 NCBI-ProteinID:  XP_020210925 LinkDB All DBs Position 3:775700..777116 Genome browser AA seq 144 aa AA seqDB search MMASSSSKKISVKCSDGMVLEVDETLVNASPTMKCLVEEKCGESNIVITLPNISSKILSK IIEFLKVDLESDATFNDVGVQSVDVDSKAPESLTSFNNLKLEFIKFDANTLLYLVTATHY LKIEKIYHLGCVEAVRRIRENAAK NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atgatggcttcatcctcatcaaagaaaatcagtgtgaagtgctctgatggcatggtgttg gaggtggacgaaactttggtgaatgcttctcctaccatgaagtgcttggtggaagaaaag tgtggtgaaagtaacattgtcatcaccttgccaaacatctccagcaaaatcttgtctaag atcattgagtttctcaaggttgacttggaaagtgatgcgactttcaatgatgttggtgtt caatctgttgatgttgatagtaaggcccctgagagtcttacaagtttcaataacttgaaa ctagagttcataaaatttgatgcaaacacacttctataccttgtcacggcaactcattat ctcaaaattgagaaaatttatcatttgggatgcgtagaagctgtgagaagaattagggaa aatgctgcgaaatag

DBGET integrated database retrieval system