Cajanus cajan (pigeon pea): 109800888 Help Entry 109800888         CDS       T04868                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism ccaj  Cajanus cajan (pigeon pea) Pathway ccaj03083   Polycomb repressive complex ccaj04120   Ubiquitin mediated proteolysis ccaj04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ccaj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109800888    04120 Ubiquitin mediated proteolysis     109800888   09126 Chromosome    03083 Polycomb repressive complex     109800888  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccaj04131]     109800888    04121 Ubiquitin system [BR:ccaj04121]     109800888    03036 Chromosome and associated proteins [BR:ccaj03036]     109800888 Membrane trafficking [BR:ccaj04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     109800888 Ubiquitin system [BR:ccaj04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      109800888    Cul7 complex      109800888 Chromosome and associated proteins [BR:ccaj03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      109800888   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      109800888 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Methyltransf_16 Motif Other DBs NCBI-GeneID:  109800888 NCBI-ProteinID:  XP_020217395 LinkDB All DBs Position 6:16020404..16023039 Genome browser AA seq 155 aa AA seqDB search MSSAKKITLKSSDGEAFEVEEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC KKHVDAANPDDKPSEEDLKAWDTDFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcggcgaagaagatcaccctgaagagctcggacggcgaggcgttcgaggtggag gaggcggtggcgctggagtcgcagacaatcaagcacatgatcgaggacgattgcgccgac agcggaatccctctccctaacgtcaccagcaagatcctggccaaggtaatcgagtactgc aaaaagcacgtcgacgccgccaaccccgacgacaaaccctccgaagaggatctcaaggct tgggacacggatttcgtcaaggtcgaccaggccacgctcttcgatctcatcctggctgcg aactacttgaatatcaagagcctgctggaccttacatgccagactgtagcagacatgatc aaggggaagactccagaggaaattcgcaagacctttaatatcaagaatgactttactcca gaggaagaagaggaagttcgtcgggaaaaccaatgggcatttgaatga

DBGET integrated database retrieval system