Cajanus cajan (pigeon pea): 109801027 Help Entry 109801027         CDS       T04868                                  Name (RefSeq) protein MHF2 homolog   KO K15360   centromere protein X Organism ccaj  Cajanus cajan (pigeon pea) Pathway ccaj03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:ccaj00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     109801027  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ccaj03400]     109801027 DNA repair and recombination proteins [BR:ccaj03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      109801027 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-X Motif Other DBs NCBI-GeneID:  109801027 NCBI-ProteinID:  XP_020217581 LinkDB All DBs Position 6:2384407..2386953 Genome browser AA seq 114 aa AA seqDB search METKHTGYCRTMEEVTFDCDLIHSILKRFWTLQALERENVEANDAPDSEVGVGTSKKNRT TFANANAVKLTSELLRIFITEAVQRAAAIADAEGASQIEPTHLEIILPQLLLDF NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggagacgaagcacacagggtattgccgtacgatggaggaagtcaccttcgactgtgat ctcattcattccattttgaagcgcttttggacattgcaagcacttgagcgcgaaaatgtt gaagccaacgacgccccggactccgaggtaggagttggaacatccaagaagaatcggaca acttttgctaatgccaatgctgtgaagcttacgtctgaacttctccgtatttttatcaca gaggctgttcaacgtgctgcggctattgcagatgcagagggtgctagtcaaatagaacct actcatttggagattattcttcctcagttacttttagatttctaa

DBGET integrated database retrieval system