Cajanus cajan (pigeon pea): 109809214 Help Entry 109809214         CDS       T04868                                  Name (RefSeq) calmodulin-like protein 11   KO K02183   calmodulin Organism ccaj  Cajanus cajan (pigeon pea) Pathway ccaj04016   MAPK signaling pathway - plant ccaj04070   Phosphatidylinositol signaling system ccaj04075   Plant hormone signal transduction ccaj04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:ccaj00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     109809214    04070 Phosphatidylinositol signaling system     109809214    04075 Plant hormone signal transduction     109809214  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     109809214  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ccaj01009]     109809214   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccaj04131]     109809214    03036 Chromosome and associated proteins [BR:ccaj03036]     109809214   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccaj04147]     109809214 Protein phosphatases and associated proteins [BR:ccaj01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      109809214 Membrane trafficking [BR:ccaj04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     109809214 Chromosome and associated proteins [BR:ccaj03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      109809214 Exosome [BR:ccaj04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    109809214 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 SPARC_Ca_bdg EH Dockerin_1 TerB EF_EFCAB10_C DUF5580_M Caleosin Fe_hyd_lg_C Motif Other DBs NCBI-GeneID:  109809214 NCBI-ProteinID:  XP_020228051 LinkDB All DBs Position 11:complement(10153069..10153900) Genome browser AA seq 148 aa AA seqDB search MASALTEDQIAEFHEAFCLIDKDSDGFITVDELAAIIRSLDGNPTKEEIQDMIGEVDVDG NGSIDFEEFLNIMGRKMKETVAEELKEAFKVFDRDQDGYISATELRHVMMNLGERLTEEE AEQMIREADLDGDGQVNFEEFARIMMLK NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggcaagtgcactcacagaagatcagattgctgaattccatgaagccttttgcctcatt gacaaggactctgatggattcattaccgtggacgaattggcagctattatccgatcacta gatgggaatccaacaaaagaagaaatccaagacatgattggtgaagtggatgttgatggg aatgggagcatagattttgaagagttcttgaatattatgggtagaaaaatgaaggaaact gtagccgaagagctcaaagaagcattcaaagtatttgatagagatcaagatggatacata tctgccactgagctgaggcacgtaatgatgaatttgggagagaggctgacagaagaagaa gctgaacaaatgattagagaggcggatttggatggggatggacaagttaactttgaagaa tttgcgaggattatgatgctcaaataa

DBGET integrated database retrieval system