Cajanus cajan (pigeon pea): 109813241 Help Entry 109813241         CDS       T04868                                  Name (RefSeq) sm-like protein LSM5   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism ccaj  Cajanus cajan (pigeon pea) Pathway ccaj03018   RNA degradation ccaj03040   Spliceosome Brite KEGG Orthology (KO) [BR:ccaj00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     109813241   09123 Folding, sorting and degradation    03018 RNA degradation     109813241  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ccaj03019]     109813241    03041 Spliceosome [BR:ccaj03041]     109813241 Messenger RNA biogenesis [BR:ccaj03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      109813241   mRNA degradation factors    5'-3' decay     Lsm complex      109813241 Spliceosome [BR:ccaj03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     109813241 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM DUF7452 Ntox4 Motif Other DBs NCBI-GeneID:  109813241 NCBI-ProteinID:  XP_020232990 LinkDB All DBs Position Unknown AA seq 88 aa AA seqDB search MANNPSQLLPSELIDRCIGSKIWVIMKGDKELVGTLRGFDVYVNMVLEDVTEYEITAEGR RITKLDQILLNGNNIAILVPGGSPEPDS NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggcaaacaacccgtcgcagcttctcccatcagaattgatcgaccggtgcataggatca aaaatatgggtgataatgaagggtgacaaggagcttgttggcactcttagaggctttgat gtttatgtcaacatggtccttgaagatgttactgaatatgagatcactgctgaagggaga cggataaccaagctcgatcagattttactcaatggaaacaacattgccattttagttcct ggtggttcacctgagccagactcatag

DBGET integrated database retrieval system