Cajanus cajan (pigeon pea): 109814516 Help Entry 109814516         CDS       T04868                                  Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism ccaj  Cajanus cajan (pigeon pea) Pathway ccaj03030   DNA replication ccaj03410   Base excision repair ccaj03420   Nucleotide excision repair ccaj03430   Mismatch repair ccaj03440   Homologous recombination Brite KEGG Orthology (KO) [BR:ccaj00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     109814516    03410 Base excision repair     109814516    03420 Nucleotide excision repair     109814516    03430 Mismatch repair     109814516    03440 Homologous recombination     109814516  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ccaj03032]     109814516    03400 DNA repair and recombination proteins [BR:ccaj03400]     109814516 DNA replication proteins [BR:ccaj03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     109814516 DNA repair and recombination proteins [BR:ccaj03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       109814516    MMR (mismatch excision repair)     DNA polymerase delta complex      109814516 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  109814516 NCBI-ProteinID:  XP_020234559 LinkDB All DBs Position Unknown AA seq 118 aa AA seqDB search MATVSGNMKGFYKQKKNTITKKSSKKSPINAATLASVAAQTPALISHAGNPELEDEHKES EVMLRQFDMNMAYGPCIGITRLARWERAQRLGLNPPQEIETLLKGGKVQPESLWDGCI NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggcgacagtgtctgggaacatgaagggtttctacaaacagaagaaaaacaccatcact aaaaaatcttccaaaaagtctccgattaacgctgccactttggcctccgttgcggcccaa acaccggccctcatctcccacgccggaaaccccgaattagaagatgaacacaaagagagc gaggtgatgctgcggcaattcgacatgaacatggcatatgggccctgcatcgggatcacg cgtctcgcacgctgggagcgtgctcagaggctcggtttgaaccctccgcaagaaatcgag accctcttaaagggtggaaaagtacagcccgagtccttgtgggatggttgcatttag

DBGET integrated database retrieval system