Cajanus cajan (pigeon pea): 109815433 Help Entry 109815433         CDS       T04868                                  Name (RefSeq) class I heat shock protein-like   KO K13993   HSP20 family protein Organism ccaj  Cajanus cajan (pigeon pea) Pathway ccaj04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ccaj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109815433  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ccaj03110]     109815433 Chaperones and folding catalysts [BR:ccaj03110]  Heat shock proteins   HSP20    109815433 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HSP20 ArsA_HSP20 Motif Other DBs NCBI-GeneID:  109815433 NCBI-ProteinID:  XP_020235747 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MSLIPSMEDSPAALMGSLGQLEWKETAEAHVLKAEVEDGRVLQVSGERNIQIHDHTLHRT TSKFKRSFTLPANAKLDHLKASIENGLLTVTVPKITHSMPIHNS NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgtctttgatcccaagcatggaggattctccggcggcgttgatgggaagcctagggcag ttggagtggaaggagacggcggaggcgcacgtgctaaaggcggaggtggaggacggaaga gttcttcaggtgagtggggagaggaacatccaaattcatgaccacacccttcaccgcacc acttccaagttcaagagatctttcacgcttcccgccaatgccaaacttgatcacctcaaa gcttccattgaaaatggccttctcactgtcactgttcccaagatcactcattccatgccc attcataattcctaa

DBGET integrated database retrieval system