Cajanus cajan (pigeon pea): 29293583 Help Entry 29293583          CDS       T04868                                  Symbol atpH, BKH98_gp058 Name (RefSeq) ATP synthase CF0 subunit IV   KO K02110   F-type H+-transporting ATPase subunit c Organism ccaj  Cajanus cajan (pigeon pea) Pathway ccaj00190   Oxidative phosphorylation ccaj00195   Photosynthesis ccaj01100   Metabolic pathways Module ccaj_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:ccaj00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     29293583 (atpH)    00195 Photosynthesis     29293583 (atpH)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:ccaj00194]     29293583 (atpH) Photosynthesis proteins [BR:ccaj00194]  Photosystem and electron transport system   F-type ATPase [OT]    29293583 (atpH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-GeneID:  29293583 NCBI-ProteinID:  YP_009309159 UniProt:  A0A151S9L1 LinkDB All DBs Position Pltd:48388..48633 Genome browser AA seq 81 aa AA seqDB search MNPIISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaatcctattatatcggctgcttccgttattgctgctggcttggccgtagggcttgcg tctattggacctggggttggtcaaggcactgctgcagggcaagctgtagaagggattgca cgacaaccagaggcagaagggaaaatacgtggtactttattgcttagtctggcttttatg gaagctttaacaatttatgggctggttgtagcattagcgcttttatttgctaatcctttt gtttaa

DBGET integrated database retrieval system