KEGG   Ceratina calcarata (carpenter bee): 108624497
Entry
108624497         CDS       T06061                                 
Name
(RefSeq) S-phase kinase-associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
ccal  Ceratina calcarata (carpenter bee)
Pathway
ccal03083  Polycomb repressive complex
ccal04120  Ubiquitin mediated proteolysis
ccal04141  Protein processing in endoplasmic reticulum
ccal04310  Wnt signaling pathway
ccal04341  Hedgehog signaling pathway - fly
ccal04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:ccal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108624497
   04120 Ubiquitin mediated proteolysis
    108624497
  09126 Chromosome
   03083 Polycomb repressive complex
    108624497
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108624497
   04341 Hedgehog signaling pathway - fly
    108624497
   04350 TGF-beta signaling pathway
    108624497
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccal04131]
    108624497
   04121 Ubiquitin system [BR:ccal04121]
    108624497
   03036 Chromosome and associated proteins [BR:ccal03036]
    108624497
Membrane trafficking [BR:ccal04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    108624497
Ubiquitin system [BR:ccal04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     108624497
   Cul7 complex
     108624497
Chromosome and associated proteins [BR:ccal03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     108624497
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     108624497
SSDB
Motif
Pfam: Skp1 Skp1_POZ BTB
Other DBs
NCBI-GeneID: 108624497
NCBI-ProteinID: XP_017879354
UniProt: A0AAJ7IXJ4
LinkDB
Position
Unknown
AA seq 162 aa
MPNIKLQSSDSEVFEVDVDIAKCSVTIKTMLEDLGMDEDEDEVVPLPNVNSAILRKVIQW
ATYHKDDPPPPEDDENKEKRTDDISSWDADFLKVDQGTLFELILAANYLDIKGLLDVTCK
TVANMIKGKTPEEIRKTFNIKNDFSASEEEQVRKENEWCEEK
NT seq 489 nt   +upstreamnt  +downstreamnt
atgcctaacatcaaactccaaagttcggacagcgaagttttcgaagtggacgtcgatatc
gcgaaatgttcagttactataaaaacgatgttggaagatctgggaatggacgaggacgag
gatgaagtcgttcctctaccaaacgttaattcagctattctcagaaaggtgatacagtgg
gccacatatcataaggatgatcctccaccaccggaagatgatgagaataaagagaaacgt
acggacgacataagctcttgggatgcagacttcttgaaggttgaccaagggacactattc
gaattaattttggcagctaactatctcgatatcaagggtctcttagatgtgacatgtaaa
actgtcgctaatatgataaaaggaaaaacacctgaagagattcgtaaaacgttcaatata
aagaacgatttttctgcctctgaggaggaacaagttcgtaaagagaatgaatggtgtgaa
gagaaatag

DBGET integrated database retrieval system