Ceratina calcarata (carpenter bee): 108632200 Help Entry 108632200         CDS       T06061                                  Name (RefSeq) ras-related protein Rac1   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ccal  Ceratina calcarata (carpenter bee) Pathway ccal04013   MAPK signaling pathway - fly ccal04145   Phagosome ccal04148   Efferocytosis ccal04310   Wnt signaling pathway ccal04620   Toll-like receptor signaling pathway ccal05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ccal00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     108632200    04310 Wnt signaling pathway     108632200  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108632200    04148 Efferocytosis     108632200  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108632200  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     108632200  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccal04131]     108632200   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccal04147]     108632200    04031 GTP-binding proteins [BR:ccal04031]     108632200 Membrane trafficking [BR:ccal04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     108632200  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     108632200   Macropinocytosis    Ras GTPases     108632200  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     108632200 Exosome [BR:ccal04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108632200   Exosomal proteins of other body fluids (saliva and urine)    108632200   Exosomal proteins of colorectal cancer cells    108632200   Exosomal proteins of bladder cancer cells    108632200 GTP-binding proteins [BR:ccal04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     108632200 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  108632200 NCBI-ProteinID:  XP_017892111 UniProt:  A0AAJ7JGD3 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPINLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVNPASFENVRAKWYPEVRHHCPATPIILVGTKLDLR EDKETIERLKDKKLAPITYPQGLSMAKEIGAVKYLECSALTQKGLKTVFDEAIRAVLCPV LQVKPKRRCFLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggccataaaatgcgtcgtcgttggtgacggagccgtgggtaagacatgtttgttg ataagctacacgacaaacgctttccccggcgaatacataccaaccgtgttcgacaactat tccgccaatgtgatggttgacgggaagccgataaacctgggattatgggacacggcgggc caagaagattacgataggctgcgtccgctctcttatccacaaacagacgtcttcttgatc tgtttctccttggtgaatccagccagcttcgagaatgtgcgtgccaagtggtatccagag gtgcgtcatcactgtccggctactcctatcatccttgtaggcaccaagctagatctgcgt gaggataaagagaccatcgaacggcttaaggataagaaacttgcacccatcacttatcca cagggtctgtccatggcgaaagagattggagcagtgaagtacctggagtgctcggcgctt actcagaagggtttgaaaaccgtcttcgacgaagccatccgagcggtactctgccccgtc ctccaggtgaagccaaaacgcagatgcttccttctataa

DBGET integrated database retrieval system