Cupriavidus campinensis: M5D45_15780 Help Entry M5D45_15780       CDS       T08350                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ccam  Cupriavidus campinensis Pathway ccam00998   Biosynthesis of various antibiotics ccam01100   Metabolic pathways ccam01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccam00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M5D45_15780    00074 Mycolic acid biosynthesis     M5D45_15780   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M5D45_15780 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  URF03932 UniProt:  A0AAE9HY07 LinkDB All DBs Position 1:3321086..3321337 Genome browser AA seq 83 aa AA seqDB search MTSPDRIAAIKQIVSEILEIEPADMTMTSRFKEDHDADSLRAIEILASLEKAFGVTISQD GLARMVNLEGVCQVVDEAASVKS NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgacttcccccgaccgcatcgccgccatcaagcagatcgtttccgaaatccttgagatc gagccggccgacatgaccatgaccagccgcttcaaggaagaccatgacgcggattcgctg cgcgccatcgaaatcctcgccagcctggagaaggctttcggcgtgaccatctcgcaggac gggctggcccgcatggtgaacctggagggcgtctgccaggtggtggatgaagccgcctcg gtcaagtcctga

DBGET integrated database retrieval system