Cupriavidus campinensis: M5D45_22330 Help Entry M5D45_22330       CDS       T08350                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ccam  Cupriavidus campinensis Pathway ccam00998   Biosynthesis of various antibiotics ccam01100   Metabolic pathways ccam01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ccam00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M5D45_22330    00074 Mycolic acid biosynthesis     M5D45_22330   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M5D45_22330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  URF07901 UniProt:  A0AAE9L5P0 LinkDB All DBs Position 2:1031136..1031393 Genome browser AA seq 85 aa AA seqDB search MTHDEIFARVAAVLEETFEIAPERITPEARLYDDLDIDSIDAVDLLVKLKPMLNKPLKPE QFKSVRTVQDVVQALALLIDSPATA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgactcacgacgaaatcttcgcgcgcgtggcggcggttctcgaggaaaccttcgagatt gccccggagcgcatcacgcccgaggcgcggctgtacgacgacctcgacatcgacagcatc gacgccgttgacctgctggtgaagctgaagccgatgctgaacaagccgctcaagcccgag cagttcaagtccgtgcgcaccgtgcaggacgtggtgcaggcgcttgcgctgctgatcgac tcgccggccaccgcctga

DBGET integrated database retrieval system