Cupriavidus campinensis: M5D45_24610 Help Entry M5D45_24610       CDS       T08350                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism ccam  Cupriavidus campinensis Brite KEGG Orthology (KO) [BR:ccam00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccam03036]     M5D45_24610    03400 DNA repair and recombination proteins [BR:ccam03400]     M5D45_24610 Chromosome and associated proteins [BR:ccam03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     M5D45_24610 DNA repair and recombination proteins [BR:ccam03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       M5D45_24610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Ustilago_mating Motif Other DBs NCBI-ProteinID:  URF06298 UniProt:  A0AAE9L3U9 LinkDB All DBs Position 2:1520680..1520961 Genome browser AA seq 93 aa AA seqDB search MRPPLTPASNTQLLRDRAETILWIKTQMAKFGLHVVDLENAGCFTTRPVAEAPGPVRFRD AQGHVWDGRGALPDWLQRAVHAGQTVEHFRVDG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgcgccctcctcttactccggcatccaatacccagttattgcgggatcgcgccgagacg atcctctggatcaagacccagatggcaaagtttggcctccatgttgtcgacttggagaat gcaggttgtttcaccacccgccctgtcgccgaagcgcccgggccggtgcgcttccgggac gctcaaggccacgtctgggacgggcgcggggctctgccggactggctgcagcgggccgtg catgccggccagacggtggagcattttcgggttgatggatag

DBGET integrated database retrieval system