Castor canadensis (American beaver): 109674302 Help Entry 109674302         CDS       T04791                                  Name (RefSeq) calmodulin-alpha-like   KO K02183   calmodulin Organism ccan  Castor canadensis (American beaver) Pathway ccan04014   Ras signaling pathway ccan04015   Rap1 signaling pathway ccan04020   Calcium signaling pathway ccan04022   cGMP-PKG signaling pathway ccan04024   cAMP signaling pathway ccan04070   Phosphatidylinositol signaling system ccan04114   Oocyte meiosis ccan04218   Cellular senescence ccan04261   Adrenergic signaling in cardiomyocytes ccan04270   Vascular smooth muscle contraction ccan04371   Apelin signaling pathway ccan04625   C-type lectin receptor signaling pathway ccan04713   Circadian entrainment ccan04720   Long-term potentiation ccan04722   Neurotrophin signaling pathway ccan04728   Dopaminergic synapse ccan04740   Olfactory transduction ccan04744   Phototransduction ccan04750   Inflammatory mediator regulation of TRP channels ccan04910   Insulin signaling pathway ccan04912   GnRH signaling pathway ccan04915   Estrogen signaling pathway ccan04916   Melanogenesis ccan04921   Oxytocin signaling pathway ccan04922   Glucagon signaling pathway ccan04924   Renin secretion ccan04925   Aldosterone synthesis and secretion ccan04970   Salivary secretion ccan04971   Gastric acid secretion ccan05010   Alzheimer disease ccan05012   Parkinson disease ccan05022   Pathways of neurodegeneration - multiple diseases ccan05031   Amphetamine addiction ccan05034   Alcoholism ccan05133   Pertussis ccan05152   Tuberculosis ccan05163   Human cytomegalovirus infection ccan05167   Kaposi sarcoma-associated herpesvirus infection ccan05170   Human immunodeficiency virus 1 infection ccan05200   Pathways in cancer ccan05214   Glioma ccan05417   Lipid and atherosclerosis ccan05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     109674302    04015 Rap1 signaling pathway     109674302    04371 Apelin signaling pathway     109674302    04020 Calcium signaling pathway     109674302    04070 Phosphatidylinositol signaling system     109674302    04024 cAMP signaling pathway     109674302    04022 cGMP-PKG signaling pathway     109674302  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     109674302    04218 Cellular senescence     109674302  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109674302   09152 Endocrine system    04910 Insulin signaling pathway     109674302    04922 Glucagon signaling pathway     109674302    04912 GnRH signaling pathway     109674302    04915 Estrogen signaling pathway     109674302    04921 Oxytocin signaling pathway     109674302    04916 Melanogenesis     109674302    04924 Renin secretion     109674302    04925 Aldosterone synthesis and secretion     109674302   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     109674302    04270 Vascular smooth muscle contraction     109674302   09154 Digestive system    04970 Salivary secretion     109674302    04971 Gastric acid secretion     109674302   09156 Nervous system    04728 Dopaminergic synapse     109674302    04720 Long-term potentiation     109674302    04722 Neurotrophin signaling pathway     109674302   09157 Sensory system    04744 Phototransduction     109674302    04740 Olfactory transduction     109674302    04750 Inflammatory mediator regulation of TRP channels     109674302   09159 Environmental adaptation    04713 Circadian entrainment     109674302  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109674302   09162 Cancer: specific types    05214 Glioma     109674302   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109674302    05163 Human cytomegalovirus infection     109674302    05167 Kaposi sarcoma-associated herpesvirus infection     109674302   09171 Infectious disease: bacterial    05133 Pertussis     109674302    05152 Tuberculosis     109674302   09164 Neurodegenerative disease    05010 Alzheimer disease     109674302    05012 Parkinson disease     109674302    05022 Pathways of neurodegeneration - multiple diseases     109674302   09165 Substance dependence    05031 Amphetamine addiction     109674302    05034 Alcoholism     109674302   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109674302    05418 Fluid shear stress and atherosclerosis     109674302  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ccan01009]     109674302   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ccan04131]     109674302    03036 Chromosome and associated proteins [BR:ccan03036]     109674302   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccan04147]     109674302 Protein phosphatases and associated proteins [BR:ccan01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      109674302 Membrane trafficking [BR:ccan04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     109674302 Chromosome and associated proteins [BR:ccan03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      109674302 Exosome [BR:ccan04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    109674302 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EFhand_Ca_insen EF-hand_11 Dockerin_1 Fe_hyd_lg_C Poly_export PhageMin_Tail DUF1103 MecA_N Motif Other DBs NCBI-GeneID:  109674302 NCBI-ProteinID:  XP_020006885 UniProt:  A0A8B7TND1 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MDDQLTEEQIAEFKEAFSLFDKDGDLTITTKELGTVMRSLGQNSTEAELQDVINEVDADG NGTIDFPGFLTMMARKMKDTDSEEEIREAFRVFGKDGNGYVSAAELRHVVTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFEQMRTAM NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggatgaccaactgactgaagagcagattgcagaattcaaagaagctttttcactattt gacaaggatggtgatttaactataacaacaaaggaattgggaactgtaatgaggtctctt gggcagaattccacagaagcagagttacaggacgtgattaatgaagtagatgctgatggt aatggaacaattgactttcctggatttctgacaatgatggcaagaaaaatgaaagacaca gacagcgaagaagaaattagagaagcattccgtgtgtttggtaaggatggcaatggctat gttagtgcagcagagcttcgccatgtggtgacaaaccttggagagaagttaacagatgaa gaggttgatgaaatgatcagggaagcagatattgatggtgatgggcaagtaaactatgaa gagtttgaacaaatgaggacagcaatgtga

DBGET integrated database retrieval system