Castor canadensis (American beaver): 109674460 Help Entry 109674460         CDS       T04791                                  Name (RefSeq) C-C motif chemokine 8-like   KO K16596   C-C motif chemokine 8 Organism ccan  Castor canadensis (American beaver) Pathway ccan04060   Cytokine-cytokine receptor interaction ccan04061   Viral protein interaction with cytokine and cytokine receptor ccan04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109674460    04061 Viral protein interaction with cytokine and cytokine receptor     109674460  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     109674460  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109674460 Cytokines and neuropeptides [BR:ccan04052]  Cytokines   Chemokines    109674460 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  109674460 NCBI-ProteinID:  XP_020007002 UniProt:  A0A8B7TJY8 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search MKVSAVLLCLMLIAAASSTHVLAQPESVTAPITCCFNMITKKIPIQKLKSYTSTQCPQEA VIFKTKQDKEICADPKEKWVKDSLKLLNQKSQTLKA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctctgcagtgcttctgtgcctgatgctcatagcagctgcctccagcacccat gtgctggctcaaccagaatctgtgacagccccgatcacctgctgctttaatatgatcact aagaagatccccatccagaagctgaagagctacaccagcacccaatgtccccaggaagct gtgatcttcaagaccaaacaggacaaggagatctgtgctgaccccaaagagaagtgggtc aaggactccctgaagctcctaaaccaaaagtcccaaaccctaaaggcttga

DBGET integrated database retrieval system