Castor canadensis (American beaver): 109674461 Help Entry 109674461         CDS       T04791                                  Name (RefSeq) eotaxin-like   KO K14624   C-C motif chemokine 2 Organism ccan  Castor canadensis (American beaver) Pathway ccan04060   Cytokine-cytokine receptor interaction ccan04061   Viral protein interaction with cytokine and cytokine receptor ccan04062   Chemokine signaling pathway ccan04621   NOD-like receptor signaling pathway ccan04657   IL-17 signaling pathway ccan04668   TNF signaling pathway ccan04933   AGE-RAGE signaling pathway in diabetic complications ccan05135   Yersinia infection ccan05142   Chagas disease ccan05144   Malaria ccan05163   Human cytomegalovirus infection ccan05164   Influenza A ccan05168   Herpes simplex virus 1 infection ccan05171   Coronavirus disease ccan05323   Rheumatoid arthritis ccan05417   Lipid and atherosclerosis ccan05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     109674461   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109674461    04061 Viral protein interaction with cytokine and cytokine receptor     109674461  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     109674461    04657 IL-17 signaling pathway     109674461    04062 Chemokine signaling pathway     109674461  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease     109674461    05164 Influenza A     109674461    05168 Herpes simplex virus 1 infection     109674461    05163 Human cytomegalovirus infection     109674461   09171 Infectious disease: bacterial    05135 Yersinia infection     109674461   09174 Infectious disease: parasitic    05144 Malaria     109674461    05142 Chagas disease     109674461   09163 Immune disease    05323 Rheumatoid arthritis     109674461   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109674461    05418 Fluid shear stress and atherosclerosis     109674461   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     109674461  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109674461    00536 Glycosaminoglycan binding proteins [BR:ccan00536]     109674461 Cytokines and neuropeptides [BR:ccan04052]  Cytokines   Chemokines    109674461 Glycosaminoglycan binding proteins [BR:ccan00536]  Heparan sulfate / Heparin   Chemokines    109674461 SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 DUF5601 DUF3431 Motif Other DBs NCBI-GeneID:  109674461 NCBI-ProteinID:  XP_020007003 UniProt:  A0A8B7THH8 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MKLSTALLCLLIAASAFSPQVLPAPDIVPITCCFAVTSKKISRQRLESYRRITNSKCPQA AVIFKTKLDKEICADPKQKWVQDFMKHLNQKILTPKP NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgaagctctccacagcccttctgtgcctgctgattgcagcatctgccttcagcccccag gtacttcctgcaccagatattgtcccaatcacttgctgctttgctgtgacaagtaagaag atctcccgtcagcgactggaaagctacagaagaatcaccaacagcaaatgtccccaggca gctgtgatcttcaagaccaaactggataaggagatctgtgctgaccctaagcagaaatgg gtccaggacttcatgaagcatctgaaccaaaaaatcctaactccaaagccataa

DBGET integrated database retrieval system