Castor canadensis (American beaver): 109676172 Help Entry 109676172         CDS       T04791                                  Name (RefSeq) cystathionine gamma-lyase-like   KO K01758   cystathionine gamma-lyase [EC:4.4.1.1] Organism ccan  Castor canadensis (American beaver) Pathway ccan00260   Glycine, serine and threonine metabolism ccan00270   Cysteine and methionine metabolism ccan00450   Selenocompound metabolism ccan00670   One carbon pool by folate ccan01100   Metabolic pathways ccan01230   Biosynthesis of amino acids Module ccan_M00338   Cysteine biosynthesis, homocysteine + serine => cysteine Brite KEGG Orthology (KO) [BR:ccan00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     109676172    00270 Cysteine and methionine metabolism     109676172   09106 Metabolism of other amino acids    00450 Selenocompound metabolism     109676172   09108 Metabolism of cofactors and vitamins    00670 One carbon pool by folate     109676172  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccan04147]     109676172 Enzymes [BR:ccan01000]  4. Lyases   4.4  Carbon-sulfur lyases    4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)     4.4.1.1  cystathionine gamma-lyase      109676172 Exosome [BR:ccan04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109676172 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cys_Met_Meta_PP Motif Other DBs NCBI-GeneID:  109676172 NCBI-ProteinID:  XP_020008257 UniProt:  A0A8B7TNE7 LinkDB All DBs Position Unknown AA seq 161 aa AA seqDB search KSFHFFQRPLALGADICMYSATKYMNGHTDVIMGLVSVNSEDLHSRLRFLQNSLGAVPSP FDCYLCNRGLKTLHIRMEKHFKNGMAVAQFLESNPRVEKVIYPGLTSHPQHELAKRQCTG CPGMISFYIKGTLQHAETFLKNLKLFVLAESLGGLKVLLSF NT seq 486 nt NT seq  +upstreamnt  +downstreamnt caaaaagctttcatttctttcagcggcctttggctctgggagctgatatttgtatgtatt ctgcaacaaaatatatgaatggccacactgatgttataatgggcttagtgtctgttaatt ctgaagacctccatagtaggcttcgtttcttgcagaattctcttggagcggttccgtctc cttttgactgctacctgtgcaatcgaggtctgaagactctacatatccgaatggagaagc atttcaaaaacggaatggcagttgcccagttcctggaatctaatccccgggtggaaaagg ttatttatcctgggctgacctctcatcctcagcatgagctggccaagcgtcagtgcacag gctgcccagggatgatcagcttttatattaagggcactcttcaacatgctgagaccttcc tcaagaacctaaagttatttgttctggctgagagtttgggaggattgaaagtcttgctga gcttcc

DBGET integrated database retrieval system