Castor canadensis (American beaver): 109677244 Help Entry 109677244         CDS       T04791                                  Name (RefSeq) histone H2A type 2-A   KO K11251   histone H2A Organism ccan  Castor canadensis (American beaver) Pathway ccan03082   ATP-dependent chromatin remodeling ccan04217   Necroptosis ccan04613   Neutrophil extracellular trap formation ccan05034   Alcoholism ccan05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ccan00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     109677244  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109677244  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109677244  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     109677244   09165 Substance dependence    05034 Alcoholism     109677244  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccan03036]     109677244   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccan04147]     109677244 Chromosome and associated proteins [BR:ccan03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109677244 Exosome [BR:ccan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109677244 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  109677244 NCBI-ProteinID:  XP_020008924 UniProt:  A0A8C0X634 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHHKAKGK NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgtggcaagcaaggaggcaaggcccgcgcgaaggccaagtcgcgctcgtcg cgcgccggccttcagttcccggtggggcgcgtgcaccgcctgctgcgcaagggcaactac gcggagcgcgtgggggccggcgcgcccgtgtacatggcggcggtgctggagtacctgacg gcggaaatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc cctcgccacctgcagctggccatccgcaacgacgaggagctgaacaagctgctggggaag gtgaccatcgcgcagggcggcgttctgcccaacatccaggccgtgctgctccctaagaag acggagagccaccacaaggcaaagggcaagtga

DBGET integrated database retrieval system