Castor canadensis (American beaver): 109677535 Help Entry 109677535         CDS       T04791                                  Name (RefSeq) histone H2B type 1-B   KO K11252   histone H2B Organism ccan  Castor canadensis (American beaver) Pathway ccan04613   Neutrophil extracellular trap formation ccan05034   Alcoholism ccan05203   Viral carcinogenesis ccan05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ccan00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109677535  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     109677535   09163 Immune disease    05322 Systemic lupus erythematosus     109677535   09165 Substance dependence    05034 Alcoholism     109677535  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccan03036]     109677535   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccan04147]     109677535 Chromosome and associated proteins [BR:ccan03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109677535 Exosome [BR:ccan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109677535 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  109677535 NCBI-ProteinID:  XP_020009055 UniProt:  A0A8B7TUS7 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MPEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgccagagccctccaagtctgctcctgctcctaagaaagggtctaagaaggccatcaca aaggcgcagaaaaaggacggcaagaagcgcaagcgaagccgaaaagaaagctattccatc tatgtatacaaggtgctgaaacaggtccacccggacaccggcatctcgtccaaggccatg ggcatcatgaactcgttcgtcaacgacatcttcgagcgcatcgcgggggaggcgtctcgc ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgaggggaccaaggccgtcacc aagtacactagctccaagtaa

DBGET integrated database retrieval system