Castor canadensis (American beaver): 109677576 Help Entry 109677576         CDS       T04791                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism ccan  Castor canadensis (American beaver) Pathway ccan04613   Neutrophil extracellular trap formation ccan05034   Alcoholism ccan05203   Viral carcinogenesis ccan05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ccan00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109677576  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     109677576   09163 Immune disease    05322 Systemic lupus erythematosus     109677576   09165 Substance dependence    05034 Alcoholism     109677576  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccan03036]     109677576 Chromosome and associated proteins [BR:ccan03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109677576 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  109677576 NCBI-ProteinID:  XP_020009073 UniProt:  A0A250Y902 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctgggagaggaaagggtgggaaaggcctaggaaaggggggtgccaagcgccaccgg aaggttctgagagacaacatccagggcatcaccaagcccgctatccggcgtctcgctcgg cgcgggggagtcaagcgcatctccggcctcatttacgaagagacccgcggcgtgctgaag gtgttcctggagaacgtcatccgggacgctgtcacctacaccgagcacgccaagcgcaag acggtcaccgccatggacgtggtctacgcgctcaagcgccagggccgcaccctgtacggc ttcggaggctaa

DBGET integrated database retrieval system