Castor canadensis (American beaver): 109677594 Help Entry 109677594         CDS       T04791                                  Name (RefSeq) histone H3   KO K11253   histone H3 Organism ccan  Castor canadensis (American beaver) Pathway ccan04613   Neutrophil extracellular trap formation ccan05034   Alcoholism ccan05202   Transcriptional misregulation in cancer ccan05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ccan00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109677594  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     109677594   09163 Immune disease    05322 Systemic lupus erythematosus     109677594   09165 Substance dependence    05034 Alcoholism     109677594  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ccan03036]     109677594   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccan04147]     109677594 Chromosome and associated proteins [BR:ccan03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109677594 Exosome [BR:ccan04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109677594 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  109677594 NCBI-ProteinID:  XP_020009083 UniProt:  A0A8C0X8W9 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtaccaagcagacggctcgcaagtccaccggcggcaaggcgccgcgcaagcag ctggccaccaaggccgcccgcaagagcgcgccggccaccggcggcgtgaagaagcctcac cgctaccggcccggcaccgtggcgctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaaactgccgttccagcgcctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggcgagcgaggcctac ctggtgggcctgtttgaggacaccaacctgtgcgccatccacgccaaacgagtaacgatc atgcccaaggacatccagctggcccgtcggattcggggggagagggcatag

DBGET integrated database retrieval system