Castor canadensis (American beaver): 109677734 Help Entry 109677734         CDS       T04791                                  Name (RefSeq) insulin-like growth factor I   KO K05459   insulin-like growth factor 1 Organism ccan  Castor canadensis (American beaver) Pathway ccan01521   EGFR tyrosine kinase inhibitor resistance ccan01522   Endocrine resistance ccan04010   MAPK signaling pathway ccan04014   Ras signaling pathway ccan04015   Rap1 signaling pathway ccan04066   HIF-1 signaling pathway ccan04068   FoxO signaling pathway ccan04081   Hormone signaling ccan04114   Oocyte meiosis ccan04115   p53 signaling pathway ccan04150   mTOR signaling pathway ccan04151   PI3K-Akt signaling pathway ccan04152   AMPK signaling pathway ccan04211   Longevity regulating pathway ccan04213   Longevity regulating pathway - multiple species ccan04510   Focal adhesion ccan04550   Signaling pathways regulating pluripotency of stem cells ccan04730   Long-term depression ccan04750   Inflammatory mediator regulation of TRP channels ccan04913   Ovarian steroidogenesis ccan04914   Progesterone-mediated oocyte maturation ccan04935   Growth hormone synthesis, secretion and action ccan04960   Aldosterone-regulated sodium reabsorption ccan05200   Pathways in cancer ccan05202   Transcriptional misregulation in cancer ccan05205   Proteoglycans in cancer ccan05214   Glioma ccan05215   Prostate cancer ccan05218   Melanoma ccan05224   Breast cancer ccan05410   Hypertrophic cardiomyopathy ccan05414   Dilated cardiomyopathy Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109677734    04014 Ras signaling pathway     109677734    04015 Rap1 signaling pathway     109677734    04066 HIF-1 signaling pathway     109677734    04068 FoxO signaling pathway     109677734    04151 PI3K-Akt signaling pathway     109677734    04152 AMPK signaling pathway     109677734    04150 mTOR signaling pathway     109677734   09133 Signaling molecules and interaction    04081 Hormone signaling     109677734  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     109677734    04115 p53 signaling pathway     109677734   09144 Cellular community - eukaryotes    04510 Focal adhesion     109677734    04550 Signaling pathways regulating pluripotency of stem cells     109677734  09150 Organismal Systems   09152 Endocrine system    04913 Ovarian steroidogenesis     109677734    04914 Progesterone-mediated oocyte maturation     109677734    04935 Growth hormone synthesis, secretion and action     109677734   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     109677734   09156 Nervous system    04730 Long-term depression     109677734   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     109677734   09149 Aging    04211 Longevity regulating pathway     109677734    04213 Longevity regulating pathway - multiple species     109677734  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109677734    05202 Transcriptional misregulation in cancer     109677734    05205 Proteoglycans in cancer     109677734   09162 Cancer: specific types    05214 Glioma     109677734    05218 Melanoma     109677734    05215 Prostate cancer     109677734    05224 Breast cancer     109677734   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     109677734    05414 Dilated cardiomyopathy     109677734   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     109677734    01522 Endocrine resistance     109677734  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ccan04052]     109677734 Cytokines and neuropeptides [BR:ccan04052]  Cytokines   Growth factors (RTK binding)    109677734 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  109677734 NCBI-ProteinID:  XP_020009156 UniProt:  A0A8B7TQA1 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search MASENTAEAPMEASCLVPPKPHNDEKSTGFTLRESCKARPERPQMNPPKLLPPAALRMTI NLPYERKQPPGSYKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSV RAQRHTDVPKTQKEVHLKNASRGSAGNKNYRM NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atggcaagtgaaaacactgctgaagctccaatggaggccagctgcctggtccctcccaaa ccccacaatgatgagaagtccacagggttcactctgagagagagctgcaaagcccgccca gagagaccacaaatgaaccctcctaagttactacctccagctgccctaagaatgacaata aacctgccttacgagaggaagcagccaccaggctcctacaagcccacaggctatggctcc agcagtaggagggcacctcagacaggcatcgtggatgagtgctgcttccggagctgtgat ctgaggaggttggagatgtattgtgcccctctcaaacctgccaagtcagcccgctctgtc cgtgcccagcgccacactgacgtgcccaagactcaaaaggaggtacatttgaagaacgca agtagagggagtgcaggaaacaagaactacagaatgtag

DBGET integrated database retrieval system