Castor canadensis (American beaver): 109679656 Help Entry 109679656         CDS       T04791                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism ccan  Castor canadensis (American beaver) Pathway ccan00190   Oxidative phosphorylation ccan01100   Metabolic pathways ccan01524   Platinum drug resistance ccan04115   p53 signaling pathway ccan04210   Apoptosis ccan04215   Apoptosis - multiple species ccan04932   Non-alcoholic fatty liver disease ccan05010   Alzheimer disease ccan05012   Parkinson disease ccan05014   Amyotrophic lateral sclerosis ccan05016   Huntington disease ccan05017   Spinocerebellar ataxia ccan05020   Prion disease ccan05022   Pathways of neurodegeneration - multiple diseases ccan05132   Salmonella infection ccan05134   Legionellosis ccan05145   Toxoplasmosis ccan05152   Tuberculosis ccan05160   Hepatitis C ccan05161   Hepatitis B ccan05162   Measles ccan05163   Human cytomegalovirus infection ccan05164   Influenza A ccan05167   Kaposi sarcoma-associated herpesvirus infection ccan05168   Herpes simplex virus 1 infection ccan05169   Epstein-Barr virus infection ccan05170   Human immunodeficiency virus 1 infection ccan05200   Pathways in cancer ccan05210   Colorectal cancer ccan05222   Small cell lung cancer ccan05416   Viral myocarditis ccan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     109679656  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     109679656    04215 Apoptosis - multiple species     109679656    04115 p53 signaling pathway     109679656  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109679656   09162 Cancer: specific types    05210 Colorectal cancer     109679656    05222 Small cell lung cancer     109679656   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109679656    05161 Hepatitis B     109679656    05160 Hepatitis C     109679656    05164 Influenza A     109679656    05162 Measles     109679656    05168 Herpes simplex virus 1 infection     109679656    05163 Human cytomegalovirus infection     109679656    05167 Kaposi sarcoma-associated herpesvirus infection     109679656    05169 Epstein-Barr virus infection     109679656   09171 Infectious disease: bacterial    05132 Salmonella infection     109679656    05134 Legionellosis     109679656    05152 Tuberculosis     109679656   09174 Infectious disease: parasitic    05145 Toxoplasmosis     109679656   09164 Neurodegenerative disease    05010 Alzheimer disease     109679656    05012 Parkinson disease     109679656    05014 Amyotrophic lateral sclerosis     109679656    05016 Huntington disease     109679656    05017 Spinocerebellar ataxia     109679656    05020 Prion disease     109679656    05022 Pathways of neurodegeneration - multiple diseases     109679656   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109679656    05416 Viral myocarditis     109679656   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     109679656   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     109679656 SSDB OrthologParalogGFIT Motif Pfam:  P22_Gp10_C bHLH-TF_ACT-like_plant Motif Other DBs NCBI-GeneID:  109679656 NCBI-ProteinID:  XP_020010383 UniProt:  A0A8B7TS56 LinkDB All DBs Position Unknown AA seq 172 aa AA seqDB search MVGATENLAFTFDNLNLNIHTVLVTTVVGNTYLEVWSHCLNEQRKSELKTGDADKNKIFV HKFAQCHILGKEEEHNTETNLHSLFGQKTGRAIGLSYTDDKNKGITWGEETLMGYLENPQ KYMPETRVIFIGAKEKGGRKDLIDYLRKTTNEKYPLLHLLKKISLLFSKYHI NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atggttggtgcaactgagaacctagcttttacttttgataacttaaacttaaatatccac acagtactagtgactactgtagtgggtaatacatatttggaagtttggagtcactgttta aatgagcaaagaaagagtgaattaaaaacaggtgatgctgataaaaacaagatttttgtt cataagtttgcccagtgtcacatattgggaaaagaagaggaacacaatactgagacaaat ctccatagtctgtttgggcagaagacaggtcgggccattgggttgtcttacacagatgac aagaacaaaggcatcacttggggagaagagacactaatgggatatctggagaatccacag aagtacatgcctgaaacaagagtcatcttcattggtgctaaggagaagggaggaagaaag gacttgatagattacctcagaaaaactactaatgagaaatacccactgcttcatttatta aaaaagatctcattgctttttagtaaatatcatatttga

DBGET integrated database retrieval system