Castor canadensis (American beaver): 109681576 Help Entry 109681576         CDS       T04791                                  Symbol Myl10 Name (RefSeq) myosin regulatory light chain 10   KO K12756   myosin regulatory light chain 10 Organism ccan  Castor canadensis (American beaver) Pathway ccan04510   Focal adhesion ccan04520   Adherens junction ccan04670   Leukocyte transendothelial migration ccan04810   Regulation of actin cytoskeleton ccan04814   Motor proteins ccan05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ccan00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     109681576 (Myl10)    04520 Adherens junction     109681576 (Myl10)   09142 Cell motility    04814 Motor proteins     109681576 (Myl10)    04810 Regulation of actin cytoskeleton     109681576 (Myl10)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     109681576 (Myl10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109681576 (Myl10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ccan04812]     109681576 (Myl10) Cytoskeleton proteins [BR:ccan04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      109681576 (Myl10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 EF_EFCAB10_C AIF-1 Motif Other DBs NCBI-GeneID:  109681576 NCBI-ProteinID:  XP_020011983 UniProt:  A0A8B7TWP2 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search MFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINF TIFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADFIKEKLMTQADRFSEEEVKQMF AAFPPDVYGNLDYRNLCYVITHGEEKD NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgttcgatcagtcccagattcaggagttcaaggaggcctttaccatcatggaccagaac cgggatggcttcatcgacaaggaagacctgagggacacctttgctgcacttggccgtatc aatgtcaagaatgaggagctggaggccatggtaaaggaggcccctgggcccatcaatttc accatcttcctcaccatgtttggggagaaactcaagggtactgacccagaggagaccatt ctccatgctttcaaggtgtttgacactgaagggaaaggcttcgtcaaggccgacttcatc aaggagaaactcatgacccaggcagaccggttcagtgaggaggaggtcaagcagatgttt gcggctttcccaccagatgtgtacggcaacttggactacaggaacctgtgctatgtcatc acgcatggagaggagaaggactag

DBGET integrated database retrieval system