Castor canadensis (American beaver): 109682703 Help Entry 109682703         CDS       T04791                                  Symbol Bax Name (RefSeq) apoptosis regulator BAX   KO K02159   apoptosis regulator BAX Organism ccan  Castor canadensis (American beaver) Pathway ccan01521   EGFR tyrosine kinase inhibitor resistance ccan01522   Endocrine resistance ccan01524   Platinum drug resistance ccan04071   Sphingolipid signaling pathway ccan04115   p53 signaling pathway ccan04141   Protein processing in endoplasmic reticulum ccan04210   Apoptosis ccan04211   Longevity regulating pathway ccan04215   Apoptosis - multiple species ccan04217   Necroptosis ccan04722   Neurotrophin signaling pathway ccan04932   Non-alcoholic fatty liver disease ccan04933   AGE-RAGE signaling pathway in diabetic complications ccan05012   Parkinson disease ccan05014   Amyotrophic lateral sclerosis ccan05016   Huntington disease ccan05020   Prion disease ccan05022   Pathways of neurodegeneration - multiple diseases ccan05132   Salmonella infection ccan05152   Tuberculosis ccan05160   Hepatitis C ccan05161   Hepatitis B ccan05162   Measles ccan05163   Human cytomegalovirus infection ccan05164   Influenza A ccan05165   Human papillomavirus infection ccan05166   Human T-cell leukemia virus 1 infection ccan05167   Kaposi sarcoma-associated herpesvirus infection ccan05168   Herpes simplex virus 1 infection ccan05169   Epstein-Barr virus infection ccan05170   Human immunodeficiency virus 1 infection ccan05200   Pathways in cancer ccan05202   Transcriptional misregulation in cancer ccan05203   Viral carcinogenesis ccan05210   Colorectal cancer ccan05212   Pancreatic cancer ccan05213   Endometrial cancer ccan05214   Glioma ccan05216   Thyroid cancer ccan05217   Basal cell carcinoma ccan05218   Melanoma ccan05220   Chronic myeloid leukemia ccan05222   Small cell lung cancer ccan05223   Non-small cell lung cancer ccan05224   Breast cancer ccan05225   Hepatocellular carcinoma ccan05226   Gastric cancer ccan05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ccan00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109682703 (Bax)  09130 Environmental Information Processing   09132 Signal transduction    04071 Sphingolipid signaling pathway     109682703 (Bax)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     109682703 (Bax)    04215 Apoptosis - multiple species     109682703 (Bax)    04217 Necroptosis     109682703 (Bax)    04115 p53 signaling pathway     109682703 (Bax)  09150 Organismal Systems   09156 Nervous system    04722 Neurotrophin signaling pathway     109682703 (Bax)   09149 Aging    04211 Longevity regulating pathway     109682703 (Bax)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109682703 (Bax)    05202 Transcriptional misregulation in cancer     109682703 (Bax)    05203 Viral carcinogenesis     109682703 (Bax)   09162 Cancer: specific types    05210 Colorectal cancer     109682703 (Bax)    05212 Pancreatic cancer     109682703 (Bax)    05225 Hepatocellular carcinoma     109682703 (Bax)    05226 Gastric cancer     109682703 (Bax)    05214 Glioma     109682703 (Bax)    05216 Thyroid cancer     109682703 (Bax)    05220 Chronic myeloid leukemia     109682703 (Bax)    05217 Basal cell carcinoma     109682703 (Bax)    05218 Melanoma     109682703 (Bax)    05213 Endometrial cancer     109682703 (Bax)    05224 Breast cancer     109682703 (Bax)    05222 Small cell lung cancer     109682703 (Bax)    05223 Non-small cell lung cancer     109682703 (Bax)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     109682703 (Bax)    05170 Human immunodeficiency virus 1 infection     109682703 (Bax)    05161 Hepatitis B     109682703 (Bax)    05160 Hepatitis C     109682703 (Bax)    05164 Influenza A     109682703 (Bax)    05162 Measles     109682703 (Bax)    05168 Herpes simplex virus 1 infection     109682703 (Bax)    05163 Human cytomegalovirus infection     109682703 (Bax)    05167 Kaposi sarcoma-associated herpesvirus infection     109682703 (Bax)    05169 Epstein-Barr virus infection     109682703 (Bax)    05165 Human papillomavirus infection     109682703 (Bax)   09171 Infectious disease: bacterial    05132 Salmonella infection     109682703 (Bax)    05152 Tuberculosis     109682703 (Bax)   09164 Neurodegenerative disease    05012 Parkinson disease     109682703 (Bax)    05014 Amyotrophic lateral sclerosis     109682703 (Bax)    05016 Huntington disease     109682703 (Bax)    05020 Prion disease     109682703 (Bax)    05022 Pathways of neurodegeneration - multiple diseases     109682703 (Bax)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     109682703 (Bax)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     109682703 (Bax)    04933 AGE-RAGE signaling pathway in diabetic complications     109682703 (Bax)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     109682703 (Bax)    01524 Platinum drug resistance     109682703 (Bax)    01522 Endocrine resistance     109682703 (Bax)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:ccan03029]     109682703 (Bax)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:ccan02000]     109682703 (Bax) Mitochondrial biogenesis [BR:ccan03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     109682703 (Bax) Transporters [BR:ccan02000]  Other transporters   Pores ion channels [TC:1]    109682703 (Bax) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 CF222 Motif Other DBs NCBI-GeneID:  109682703 NCBI-ProteinID:  XP_020013678 UniProt:  A0A250YBQ3 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGETPELTLEQMHQDASTKKLS ECLKRIGDELDSNMELQRMIADVDTDSPREVFFRVAADMFADGNFNWGRVVALFYFASKL VLKALCTKVPELIRTIMGWTLEFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV LTASLTIWKKMG NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atggatgggtccggggagcagcccagaggaggcgggcccaccagctctgagcagatcatg aagacgggggcccttttgcttcagggtttcatccaggatcgagcagggcggatggggggg gagacaccggagctgaccttggagcagatgcaccaggatgcgtccaccaagaagctgagc gagtgtctcaagcgcatcggggacgaactggacagtaatatggagctgcagaggatgatt gcagatgtggacacagactccccccgagaggtctttttccgagtggcagctgacatgttt gccgacggcaacttcaattggggccgggttgtcgcccttttctactttgccagcaaactg gtgctcaaggccctgtgcaccaaggtaccggagctgatcagaaccatcatgggctggacg ctggaattcctccgagaacggctgctaggctggatccaagaccagggtggttgggacggc ctcctttcctactttgggacccccacgtggcagacagtgaccatctttgtggctggagtg ctcactgcctcgctcaccatttggaagaagatgggctga

DBGET integrated database retrieval system