KEGG   Castor canadensis (American beaver): 109683259
Entry
109683259         CDS       T04791                                 
Symbol
Mapk3
Name
(RefSeq) mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan01521  EGFR tyrosine kinase inhibitor resistance
ccan01522  Endocrine resistance
ccan01524  Platinum drug resistance
ccan04010  MAPK signaling pathway
ccan04012  ErbB signaling pathway
ccan04014  Ras signaling pathway
ccan04015  Rap1 signaling pathway
ccan04022  cGMP-PKG signaling pathway
ccan04024  cAMP signaling pathway
ccan04062  Chemokine signaling pathway
ccan04066  HIF-1 signaling pathway
ccan04068  FoxO signaling pathway
ccan04071  Sphingolipid signaling pathway
ccan04072  Phospholipase D signaling pathway
ccan04114  Oocyte meiosis
ccan04140  Autophagy - animal
ccan04148  Efferocytosis
ccan04150  mTOR signaling pathway
ccan04151  PI3K-Akt signaling pathway
ccan04210  Apoptosis
ccan04218  Cellular senescence
ccan04261  Adrenergic signaling in cardiomyocytes
ccan04270  Vascular smooth muscle contraction
ccan04350  TGF-beta signaling pathway
ccan04360  Axon guidance
ccan04370  VEGF signaling pathway
ccan04371  Apelin signaling pathway
ccan04380  Osteoclast differentiation
ccan04510  Focal adhesion
ccan04517  IgSF CAM signaling
ccan04520  Adherens junction
ccan04540  Gap junction
ccan04550  Signaling pathways regulating pluripotency of stem cells
ccan04611  Platelet activation
ccan04613  Neutrophil extracellular trap formation
ccan04620  Toll-like receptor signaling pathway
ccan04621  NOD-like receptor signaling pathway
ccan04625  C-type lectin receptor signaling pathway
ccan04650  Natural killer cell mediated cytotoxicity
ccan04657  IL-17 signaling pathway
ccan04658  Th1 and Th2 cell differentiation
ccan04659  Th17 cell differentiation
ccan04660  T cell receptor signaling pathway
ccan04662  B cell receptor signaling pathway
ccan04664  Fc epsilon RI signaling pathway
ccan04666  Fc gamma R-mediated phagocytosis
ccan04668  TNF signaling pathway
ccan04713  Circadian entrainment
ccan04720  Long-term potentiation
ccan04722  Neurotrophin signaling pathway
ccan04723  Retrograde endocannabinoid signaling
ccan04724  Glutamatergic synapse
ccan04725  Cholinergic synapse
ccan04726  Serotonergic synapse
ccan04730  Long-term depression
ccan04810  Regulation of actin cytoskeleton
ccan04910  Insulin signaling pathway
ccan04912  GnRH signaling pathway
ccan04914  Progesterone-mediated oocyte maturation
ccan04915  Estrogen signaling pathway
ccan04916  Melanogenesis
ccan04917  Prolactin signaling pathway
ccan04919  Thyroid hormone signaling pathway
ccan04921  Oxytocin signaling pathway
ccan04926  Relaxin signaling pathway
ccan04928  Parathyroid hormone synthesis, secretion and action
ccan04929  GnRH secretion
ccan04930  Type II diabetes mellitus
ccan04933  AGE-RAGE signaling pathway in diabetic complications
ccan04934  Cushing syndrome
ccan04935  Growth hormone synthesis, secretion and action
ccan04960  Aldosterone-regulated sodium reabsorption
ccan05010  Alzheimer disease
ccan05020  Prion disease
ccan05022  Pathways of neurodegeneration - multiple diseases
ccan05034  Alcoholism
ccan05132  Salmonella infection
ccan05133  Pertussis
ccan05135  Yersinia infection
ccan05140  Leishmaniasis
ccan05142  Chagas disease
ccan05145  Toxoplasmosis
ccan05152  Tuberculosis
ccan05160  Hepatitis C
ccan05161  Hepatitis B
ccan05163  Human cytomegalovirus infection
ccan05164  Influenza A
ccan05165  Human papillomavirus infection
ccan05166  Human T-cell leukemia virus 1 infection
ccan05167  Kaposi sarcoma-associated herpesvirus infection
ccan05170  Human immunodeficiency virus 1 infection
ccan05171  Coronavirus disease - COVID-19
ccan05200  Pathways in cancer
ccan05203  Viral carcinogenesis
ccan05205  Proteoglycans in cancer
ccan05206  MicroRNAs in cancer
ccan05207  Chemical carcinogenesis - receptor activation
ccan05208  Chemical carcinogenesis - reactive oxygen species
ccan05210  Colorectal cancer
ccan05211  Renal cell carcinoma
ccan05212  Pancreatic cancer
ccan05213  Endometrial cancer
ccan05214  Glioma
ccan05215  Prostate cancer
ccan05216  Thyroid cancer
ccan05218  Melanoma
ccan05219  Bladder cancer
ccan05220  Chronic myeloid leukemia
ccan05221  Acute myeloid leukemia
ccan05223  Non-small cell lung cancer
ccan05224  Breast cancer
ccan05225  Hepatocellular carcinoma
ccan05226  Gastric cancer
ccan05230  Central carbon metabolism in cancer
ccan05231  Choline metabolism in cancer
ccan05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ccan05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109683259 (Mapk3)
   04012 ErbB signaling pathway
    109683259 (Mapk3)
   04014 Ras signaling pathway
    109683259 (Mapk3)
   04015 Rap1 signaling pathway
    109683259 (Mapk3)
   04350 TGF-beta signaling pathway
    109683259 (Mapk3)
   04370 VEGF signaling pathway
    109683259 (Mapk3)
   04371 Apelin signaling pathway
    109683259 (Mapk3)
   04668 TNF signaling pathway
    109683259 (Mapk3)
   04066 HIF-1 signaling pathway
    109683259 (Mapk3)
   04068 FoxO signaling pathway
    109683259 (Mapk3)
   04072 Phospholipase D signaling pathway
    109683259 (Mapk3)
   04071 Sphingolipid signaling pathway
    109683259 (Mapk3)
   04024 cAMP signaling pathway
    109683259 (Mapk3)
   04022 cGMP-PKG signaling pathway
    109683259 (Mapk3)
   04151 PI3K-Akt signaling pathway
    109683259 (Mapk3)
   04150 mTOR signaling pathway
    109683259 (Mapk3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    109683259 (Mapk3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109683259 (Mapk3)
   04148 Efferocytosis
    109683259 (Mapk3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    109683259 (Mapk3)
   04210 Apoptosis
    109683259 (Mapk3)
   04218 Cellular senescence
    109683259 (Mapk3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109683259 (Mapk3)
   04520 Adherens junction
    109683259 (Mapk3)
   04540 Gap junction
    109683259 (Mapk3)
   04550 Signaling pathways regulating pluripotency of stem cells
    109683259 (Mapk3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109683259 (Mapk3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109683259 (Mapk3)
   04613 Neutrophil extracellular trap formation
    109683259 (Mapk3)
   04620 Toll-like receptor signaling pathway
    109683259 (Mapk3)
   04621 NOD-like receptor signaling pathway
    109683259 (Mapk3)
   04625 C-type lectin receptor signaling pathway
    109683259 (Mapk3)
   04650 Natural killer cell mediated cytotoxicity
    109683259 (Mapk3)
   04660 T cell receptor signaling pathway
    109683259 (Mapk3)
   04658 Th1 and Th2 cell differentiation
    109683259 (Mapk3)
   04659 Th17 cell differentiation
    109683259 (Mapk3)
   04657 IL-17 signaling pathway
    109683259 (Mapk3)
   04662 B cell receptor signaling pathway
    109683259 (Mapk3)
   04664 Fc epsilon RI signaling pathway
    109683259 (Mapk3)
   04666 Fc gamma R-mediated phagocytosis
    109683259 (Mapk3)
   04062 Chemokine signaling pathway
    109683259 (Mapk3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109683259 (Mapk3)
   04929 GnRH secretion
    109683259 (Mapk3)
   04912 GnRH signaling pathway
    109683259 (Mapk3)
   04915 Estrogen signaling pathway
    109683259 (Mapk3)
   04914 Progesterone-mediated oocyte maturation
    109683259 (Mapk3)
   04917 Prolactin signaling pathway
    109683259 (Mapk3)
   04921 Oxytocin signaling pathway
    109683259 (Mapk3)
   04926 Relaxin signaling pathway
    109683259 (Mapk3)
   04935 Growth hormone synthesis, secretion and action
    109683259 (Mapk3)
   04919 Thyroid hormone signaling pathway
    109683259 (Mapk3)
   04928 Parathyroid hormone synthesis, secretion and action
    109683259 (Mapk3)
   04916 Melanogenesis
    109683259 (Mapk3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109683259 (Mapk3)
   04270 Vascular smooth muscle contraction
    109683259 (Mapk3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    109683259 (Mapk3)
  09156 Nervous system
   04724 Glutamatergic synapse
    109683259 (Mapk3)
   04725 Cholinergic synapse
    109683259 (Mapk3)
   04726 Serotonergic synapse
    109683259 (Mapk3)
   04720 Long-term potentiation
    109683259 (Mapk3)
   04730 Long-term depression
    109683259 (Mapk3)
   04723 Retrograde endocannabinoid signaling
    109683259 (Mapk3)
   04722 Neurotrophin signaling pathway
    109683259 (Mapk3)
  09158 Development and regeneration
   04360 Axon guidance
    109683259 (Mapk3)
   04380 Osteoclast differentiation
    109683259 (Mapk3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109683259 (Mapk3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109683259 (Mapk3)
   05206 MicroRNAs in cancer
    109683259 (Mapk3)
   05205 Proteoglycans in cancer
    109683259 (Mapk3)
   05207 Chemical carcinogenesis - receptor activation
    109683259 (Mapk3)
   05208 Chemical carcinogenesis - reactive oxygen species
    109683259 (Mapk3)
   05203 Viral carcinogenesis
    109683259 (Mapk3)
   05230 Central carbon metabolism in cancer
    109683259 (Mapk3)
   05231 Choline metabolism in cancer
    109683259 (Mapk3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109683259 (Mapk3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109683259 (Mapk3)
   05212 Pancreatic cancer
    109683259 (Mapk3)
   05225 Hepatocellular carcinoma
    109683259 (Mapk3)
   05226 Gastric cancer
    109683259 (Mapk3)
   05214 Glioma
    109683259 (Mapk3)
   05216 Thyroid cancer
    109683259 (Mapk3)
   05221 Acute myeloid leukemia
    109683259 (Mapk3)
   05220 Chronic myeloid leukemia
    109683259 (Mapk3)
   05218 Melanoma
    109683259 (Mapk3)
   05211 Renal cell carcinoma
    109683259 (Mapk3)
   05219 Bladder cancer
    109683259 (Mapk3)
   05215 Prostate cancer
    109683259 (Mapk3)
   05213 Endometrial cancer
    109683259 (Mapk3)
   05224 Breast cancer
    109683259 (Mapk3)
   05223 Non-small cell lung cancer
    109683259 (Mapk3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109683259 (Mapk3)
   05170 Human immunodeficiency virus 1 infection
    109683259 (Mapk3)
   05161 Hepatitis B
    109683259 (Mapk3)
   05160 Hepatitis C
    109683259 (Mapk3)
   05171 Coronavirus disease - COVID-19
    109683259 (Mapk3)
   05164 Influenza A
    109683259 (Mapk3)
   05163 Human cytomegalovirus infection
    109683259 (Mapk3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109683259 (Mapk3)
   05165 Human papillomavirus infection
    109683259 (Mapk3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109683259 (Mapk3)
   05135 Yersinia infection
    109683259 (Mapk3)
   05133 Pertussis
    109683259 (Mapk3)
   05152 Tuberculosis
    109683259 (Mapk3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109683259 (Mapk3)
   05140 Leishmaniasis
    109683259 (Mapk3)
   05142 Chagas disease
    109683259 (Mapk3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109683259 (Mapk3)
   05020 Prion disease
    109683259 (Mapk3)
   05022 Pathways of neurodegeneration - multiple diseases
    109683259 (Mapk3)
  09165 Substance dependence
   05034 Alcoholism
    109683259 (Mapk3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    109683259 (Mapk3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    109683259 (Mapk3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109683259 (Mapk3)
   04934 Cushing syndrome
    109683259 (Mapk3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109683259 (Mapk3)
   01524 Platinum drug resistance
    109683259 (Mapk3)
   01522 Endocrine resistance
    109683259 (Mapk3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccan01001]
    109683259 (Mapk3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccan03036]
    109683259 (Mapk3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccan04147]
    109683259 (Mapk3)
Enzymes [BR:ccan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109683259 (Mapk3)
Protein kinases [BR:ccan01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109683259 (Mapk3)
Chromosome and associated proteins [BR:ccan03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     109683259 (Mapk3)
Exosome [BR:ccan04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109683259 (Mapk3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 109683259
NCBI-ProteinID: XP_020014593
UniProt: A0A8B7U4B6
LinkDB
Position
Unknown
AA seq 381 aa
MAAVAAAAQGGGGGETRGADGVGPGVSGEVEIVKGQPFDVGPRYTQLQYIGEGAYGMVSS
AYDHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRAPTLEAMRDI
YIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTC
DLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEM
LSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPK
SDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKE
RLKELIFQETARFQPGASEAP
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggcggcggtggcggcggcggctcaggggggcgggggcggggagacccggggagctgat
ggggtcggcccgggggtctcaggggaagtggagatagtgaaggggcagccgttcgacgtg
ggcccgcgctacacgcaactgcagtacatcggcgagggcgcgtacggcatggtcagctcg
gcttatgaccacgtgcgcaagactcgtgtggccatcaagaagatcagcccctttgagcat
cagacctactgccagcgcactctccgtgagattcagatcttgctgcgcttccgccatgag
aatgtcataggcattcgagacattctccgtgcacccaccctggaagccatgagagatatc
tatattgtgcaggacctgatggagacagacctgtacaagttgctcaaaagccagcagctg
agcaatgaccacatctgctacttcctctaccagatcctgcggggcctcaagtatatccat
tcagccaatgtgctgcaccgggacctgaaaccctccaacctgctcatcaataccacctgt
gaccttaagatctgtgactttggcctggcccggatcgcggaccctgagcatgaccacact
ggcttcctgacagagtatgtggccacgcgctggtaccgggccccggagatcatgcttaac
tccaagggctataccaagtccatcgacatctggtctgtgggctgcattctggctgagatg
ctctccaaccggcccatcttccctggcaagcactacctggaccagctcaaccacattttg
ggtatcctgggctccccatcccaggaggatctgaattgtatcatcaacatgaaagcccga
aattacctgcagtctttgccctccaagaccaaggtggcctgggccaagctttttcccaag
tcagactccaaagctcttgacctgctggatcggatgttaaccttcaaccccaacaagcgg
atcaccgtggaggaagcactggcccacccctatctggagcagtactatgacccgacggat
gagccagtggctgaggagcccttcactttcgacatggagctggatgacctacccaaggaa
cggctgaaagagctcatcttccaggagactgcccgcttccagccaggggcctcagaggcc
ccctaa

DBGET integrated database retrieval system