Castor canadensis (American beaver): 109683738 Help Entry 109683738         CDS       T04791                                  Symbol Prkcb Name (RefSeq) protein kinase C beta type   KO K19662   classical protein kinase C beta type [EC:2.7.11.13] Organism ccan  Castor canadensis (American beaver) Pathway ccan01521   EGFR tyrosine kinase inhibitor resistance ccan04010   MAPK signaling pathway ccan04012   ErbB signaling pathway ccan04014   Ras signaling pathway ccan04015   Rap1 signaling pathway ccan04020   Calcium signaling pathway ccan04062   Chemokine signaling pathway ccan04064   NF-kappa B signaling pathway ccan04066   HIF-1 signaling pathway ccan04070   Phosphatidylinositol signaling system ccan04071   Sphingolipid signaling pathway ccan04082   Neuroactive ligand signaling ccan04150   mTOR signaling pathway ccan04270   Vascular smooth muscle contraction ccan04310   Wnt signaling pathway ccan04370   VEGF signaling pathway ccan04510   Focal adhesion ccan04540   Gap junction ccan04613   Neutrophil extracellular trap formation ccan04650   Natural killer cell mediated cytotoxicity ccan04662   B cell receptor signaling pathway ccan04666   Fc gamma R-mediated phagocytosis ccan04670   Leukocyte transendothelial migration ccan04713   Circadian entrainment ccan04720   Long-term potentiation ccan04723   Retrograde endocannabinoid signaling ccan04724   Glutamatergic synapse ccan04725   Cholinergic synapse ccan04726   Serotonergic synapse ccan04727   GABAergic synapse ccan04728   Dopaminergic synapse ccan04730   Long-term depression ccan04750   Inflammatory mediator regulation of TRP channels ccan04911   Insulin secretion ccan04912   GnRH signaling pathway ccan04916   Melanogenesis ccan04918   Thyroid hormone synthesis ccan04919   Thyroid hormone signaling pathway ccan04921   Oxytocin signaling pathway ccan04925   Aldosterone synthesis and secretion ccan04928   Parathyroid hormone synthesis, secretion and action ccan04929   GnRH secretion ccan04931   Insulin resistance ccan04933   AGE-RAGE signaling pathway in diabetic complications ccan04935   Growth hormone synthesis, secretion and action ccan04960   Aldosterone-regulated sodium reabsorption ccan04961   Endocrine and other factor-regulated calcium reabsorption ccan04970   Salivary secretion ccan04971   Gastric acid secretion ccan04972   Pancreatic secretion ccan04973   Carbohydrate digestion and absorption ccan05017   Spinocerebellar ataxia ccan05022   Pathways of neurodegeneration - multiple diseases ccan05031   Amphetamine addiction ccan05032   Morphine addiction ccan05140   Leishmaniasis ccan05143   African trypanosomiasis ccan05146   Amoebiasis ccan05161   Hepatitis B ccan05163   Human cytomegalovirus infection ccan05164   Influenza A ccan05170   Human immunodeficiency virus 1 infection ccan05171   Coronavirus disease - COVID-19 ccan05200   Pathways in cancer ccan05205   Proteoglycans in cancer ccan05206   MicroRNAs in cancer ccan05207   Chemical carcinogenesis - receptor activation ccan05214   Glioma ccan05223   Non-small cell lung cancer ccan05225   Hepatocellular carcinoma ccan05231   Choline metabolism in cancer ccan05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:ccan00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109683738 (Prkcb)    04012 ErbB signaling pathway     109683738 (Prkcb)    04014 Ras signaling pathway     109683738 (Prkcb)    04015 Rap1 signaling pathway     109683738 (Prkcb)    04310 Wnt signaling pathway     109683738 (Prkcb)    04370 VEGF signaling pathway     109683738 (Prkcb)    04064 NF-kappa B signaling pathway     109683738 (Prkcb)    04066 HIF-1 signaling pathway     109683738 (Prkcb)    04020 Calcium signaling pathway     109683738 (Prkcb)    04070 Phosphatidylinositol signaling system     109683738 (Prkcb)    04071 Sphingolipid signaling pathway     109683738 (Prkcb)    04150 mTOR signaling pathway     109683738 (Prkcb)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     109683738 (Prkcb)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     109683738 (Prkcb)    04540 Gap junction     109683738 (Prkcb)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109683738 (Prkcb)    04650 Natural killer cell mediated cytotoxicity     109683738 (Prkcb)    04662 B cell receptor signaling pathway     109683738 (Prkcb)    04666 Fc gamma R-mediated phagocytosis     109683738 (Prkcb)    04670 Leukocyte transendothelial migration     109683738 (Prkcb)    04062 Chemokine signaling pathway     109683738 (Prkcb)   09152 Endocrine system    04911 Insulin secretion     109683738 (Prkcb)    04929 GnRH secretion     109683738 (Prkcb)    04912 GnRH signaling pathway     109683738 (Prkcb)    04921 Oxytocin signaling pathway     109683738 (Prkcb)    04935 Growth hormone synthesis, secretion and action     109683738 (Prkcb)    04918 Thyroid hormone synthesis     109683738 (Prkcb)    04919 Thyroid hormone signaling pathway     109683738 (Prkcb)    04928 Parathyroid hormone synthesis, secretion and action     109683738 (Prkcb)    04916 Melanogenesis     109683738 (Prkcb)    04925 Aldosterone synthesis and secretion     109683738 (Prkcb)   09153 Circulatory system    04270 Vascular smooth muscle contraction     109683738 (Prkcb)   09154 Digestive system    04970 Salivary secretion     109683738 (Prkcb)    04971 Gastric acid secretion     109683738 (Prkcb)    04972 Pancreatic secretion     109683738 (Prkcb)    04973 Carbohydrate digestion and absorption     109683738 (Prkcb)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     109683738 (Prkcb)    04961 Endocrine and other factor-regulated calcium reabsorption     109683738 (Prkcb)   09156 Nervous system    04724 Glutamatergic synapse     109683738 (Prkcb)    04727 GABAergic synapse     109683738 (Prkcb)    04725 Cholinergic synapse     109683738 (Prkcb)    04728 Dopaminergic synapse     109683738 (Prkcb)    04726 Serotonergic synapse     109683738 (Prkcb)    04720 Long-term potentiation     109683738 (Prkcb)    04730 Long-term depression     109683738 (Prkcb)    04723 Retrograde endocannabinoid signaling     109683738 (Prkcb)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     109683738 (Prkcb)   09159 Environmental adaptation    04713 Circadian entrainment     109683738 (Prkcb)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109683738 (Prkcb)    05206 MicroRNAs in cancer     109683738 (Prkcb)    05205 Proteoglycans in cancer     109683738 (Prkcb)    05207 Chemical carcinogenesis - receptor activation     109683738 (Prkcb)    05231 Choline metabolism in cancer     109683738 (Prkcb)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     109683738 (Prkcb)    05214 Glioma     109683738 (Prkcb)    05223 Non-small cell lung cancer     109683738 (Prkcb)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     109683738 (Prkcb)    05161 Hepatitis B     109683738 (Prkcb)    05171 Coronavirus disease - COVID-19     109683738 (Prkcb)    05164 Influenza A     109683738 (Prkcb)    05163 Human cytomegalovirus infection     109683738 (Prkcb)   09174 Infectious disease: parasitic    05146 Amoebiasis     109683738 (Prkcb)    05140 Leishmaniasis     109683738 (Prkcb)    05143 African trypanosomiasis     109683738 (Prkcb)   09164 Neurodegenerative disease    05017 Spinocerebellar ataxia     109683738 (Prkcb)    05022 Pathways of neurodegeneration - multiple diseases     109683738 (Prkcb)   09165 Substance dependence    05031 Amphetamine addiction     109683738 (Prkcb)    05032 Morphine addiction     109683738 (Prkcb)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     109683738 (Prkcb)   09167 Endocrine and metabolic disease    04931 Insulin resistance     109683738 (Prkcb)    04933 AGE-RAGE signaling pathway in diabetic complications     109683738 (Prkcb)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     109683738 (Prkcb)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ccan01001]     109683738 (Prkcb) Enzymes [BR:ccan01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.13  protein kinase C      109683738 (Prkcb) Protein kinases [BR:ccan01001]  Serine/threonine kinases: AGC group   PKC family [OT]    109683738 (Prkcb) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr C2 C1_1 Pkinase_C Kinase-like ABC1 CEP76-C2 Motif Other DBs NCBI-GeneID:  109683738 NCBI-ProteinID:  XP_020015340 UniProt:  A0A8B7UBS4 LinkDB All DBs Position Unknown AA seq 617 aa AA seqDB search SYFYFGTQLLLVVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCD HCGSLLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDILIVV VRDAKNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDK DRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSE GNEELRQKFERAKVGQGTKTPEEKTTNTISKFDNSGNRDRVKLTDFNFLMVLGKGSFGKV MLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRL YFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDS EGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLA GQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKE HAFFRYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEF EGFSFVNSEFLKPEVKS NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt agttatttttattttggcacacagcttttacttgttgtttgctgctttgttgtgcacaag cggtgccatgaatttgtcacgttctcctgccctggcgctgacaagggcccagcctctgat gacccccggagcaagcacaagttcaagatccacacctactccagccccacattttgtgac cactgtggctcgctgctttatggacttatccaccaggggatgaaatgtgacacctgcatg atgaacgtccacaagcgctgcgtgatgaacgtccccagcctctgtggcactgaccacacg gagcgtcgaggccgcatttacatccaggcccatatcgacagggacatcctcattgttgtt gttagagatgctaaaaaccttgtacctatggaccctaatggcttatcagacccctacgtc aaactgaaactgattcctgaccccaaaagtgagagcaagcagaagaccaaaaccatcaag tgttccctcaaccctgaatggaacgagaccttccggtttcagctgaaagaatcagacaag gacaggaggctctctgtggagatttgggactgggatctgaccagcaggaatgacttcatg ggctcattgtcatttgggatttctgaactgcaaaaagctggtgttgatggctggttcaag ttactgagccaggaggaaggcgaatacttcaatgtgcctgtgccaccagaagggagcgag ggcaatgaggagctgcggcagaaatttgagagggccaaggttgggcaggggaccaagacc ccagaagagaagacaaccaacactatttccaagtttgacaacagtggtaacagggaccgg gtgaaactgaccgactttaacttcctgatggtgctggggaagggcagctttggcaaggtc atgctgtcagaacggaagggcacagatgagctctatgctgtgaagatcctgaagaaggat gtggtgattcaagatgatgatgtggagtgcacaatggtggagaagcgggtgctggccttg cctgggaagccaccgttcctgacccagctccactcctgtttccagactatggaccgcctg tactttgtgatggagtatgtgaatgggggtgacctcatgtaccacatccagcaagttggc cggttcaaggagccccatgctgtattttatgctgcagaaattgccataggtctgttcttc ttacagagcaagggcattatttaccgtgacctcaaacttgacaacgtgatgctggactct gaggggcacatcaagattgctgactttggcatgtgtaaggagaatatctgggacggggtg acaaccaagacattctgtgggaccccagactacatcgccccagagatcattgcttatcag ccctatgggaagtccgtggattggtgggcattcggagtcctgctgtacgaaatgttggct gggcaggcacctttcgaaggggaagatgaggatgaactcttccaatccatcatggaacac aacgtggcttatcccaagtccatgtccaaggaggctgtggccatctgcaaaggactgatg accaagcatccaggcaaacgcctgggttgtggacctgaaggggaacgtgacatcaaggaa cacgcatttttccggtatattgattgggagaaacttgaacgcaaagagattcagcctcca tataaaccaaaagcttgtgggcgaaatgctgaaaacttcgaccgatttttcacccgccat ccaccagtcctaacacctcctgaccaggaagtcatcaggaatattgaccaatcagaattc gaaggattttcctttgttaactctgaatttttaaaacctgaagtcaagagctaa

DBGET integrated database retrieval system